KEGG   Rattus norvegicus (rat): 288025Help
Entry
288025            CDS       T01003                                 

Gene name
Hrasls, A-C1
Definition
(RefSeq) HRAS-like suppressor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 288025
NCBI-ProteinID: NP_001099341
RGD: 1309485
Ensembl: ENSRNOG00000001711
UniProt: D2KX21
Position
11q22
AA seq 167 aa AA seqDB search
MAVNDCFSLTYPHNPHPGDLIEVFRPCYQHWALYLGDGYVINIAPVDGIPSSFSSAKSVF
STKALVKMQLLKDVVGNDTYRINNKYDTTYPPLPVEEVIQRSEFAIGQEVTYDLLVNNCE
HFVTLLRYGEGVSEQANRAIGTIGLVAAGIDIFTFLGLFPKRQGAKS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcggttaacgattgcttcagtctgacctatcctcacaacccccacccaggagacttg
attgaagtgttccgtccttgttatcagcactgggcactgtacttgggtgatggctacgtt
atcaacattgcacctgtagatggcattccctcatcattttcaagtgccaagtctgtgttc
agcacaaaggccttggtgaaaatgcagcttttgaaggatgttgtgggaaatgacacatac
agaataaataacaagtacgacacgacctaccctcctctccctgtggaggaagtgatacaa
cggtcagagttcgcgattgggcaggaagtaacctatgacttactggtcaacaactgtgag
cattttgtgaccttgctccgctatggagaaggagtgtcagagcaggccaaccgagcaatc
ggcaccatcgggttggtggcagctggtattgatatcttcacattccttggcttgtttccc
aaaagacaaggagcaaaatcttag

DBGET integrated database retrieval system