KEGG   Rattus norvegicus (rat): 288026
Entry
288026            CDS       T01003                                 

Gene name
Atp13a4
Definition
(RefSeq) probable cation-transporting ATPase 13A4
  KO
K14951  cation-transporting P-type ATPase 13A3/4/5 [EC:7.2.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    288026 (Atp13a4)
SSDB
Motif
Pfam: E1-E2_ATPase P5-ATPase Hydrolase Cation_ATPase_N Cation_ATPase DUF2620
Other DBs
NCBI-GeneID: 288026
NCBI-ProteinID: NP_001178587
RGD: 1306927
Ensembl: ENSRNOG00000001714
UniProt: F1M9L4
Position
11
AA seq 1193 aa
MGDHLGKSQHALLNEGDENEMEIFGYRTQGCRKALCLIGSIFSLGMLPLVFYWRPAWRVW
ANCVPCSLQEADIVLLRTTDEFKIYSWKKVMWISLSALSSTSGLTPDHPLIADEEFIINR
AIRKPDLKVRYIKVQKIRYVWNNLEGQFQKIGSLEDCLSSAKIHQKFGLGLTSEEQEIRR
LICGPNAIDVEIIPIWKLLVKEVLNPFYIFQLFSVCLWFSEDYKEYALAIILMSVISIAL
TVYDLRQQSVKLHHLVESHNSITVSVYERKAGAQDLESRLLVPGDLLILTGSRVQMPCDA
VLIDGSCVVDEGMLTGESIPVTKTPLSQTASSAPWKMQSEADPRRHILFCGTEVIQAKAA
GSGTVRAVVLQTGFNTAKGDLVRSILYPKPMNFKLYRDAIRFLLCLVGTATIGMIYTLCV
YVLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKKGIFCISPQRINVCGQ
LNLVCFDKTGTLTRGGLDLWGVVPCDQNGFQAVHSFASGEAVPWGPLCAAMATCHSLILL
DGTIQGDPLDLKMFEATQWEMTVSGDDFHNKEMLAHTMVVKPPDTVGQVPAEGLAILHQF
PFSSALQRMTVIVQETGGGRMAFMKGAPERVASFCQPDTVPTTFISELQVYTTQGFRVIA
LAYKKLETDCPTTTLMREKVESDLIFLGLLILENRLKEETRPVLEELISARIRTAMITGD
NLQTAITVARKSGMVSEGQKVILVEANEATDSSSASITWKLVEEKKHGLFGSQDTYINIR
EEVPENGREGNYHFALSGKSFQVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQKL
DYFVGMCGDGANDCGALKMAHVGVSLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVT
SFCMFKYMALYSMIQYVGVLLLYWKTNSLSNYQFLFQDLAITTLIGVTMNLNGANPKLVP
FRPAGRLISPPLLLSVILNILLSLAMHIVGFILVQKQPWYSMDYHSVCPVRNESVSALSA
SPNVPEKTRSNSTFASFENTTIWFLGTINCIVVALVFSKGKPFRQPTYTNYIFVLVLILQ
MGVCLFILFADIPELHRRLDLLCTPVLWRVYILIMVSSNFVVSLAVEKAIIENRALWTAV
KRCFGYHSKSQYRVWQRNLATDSSWPPLNQTSYSDMQGVSYSNPVFESNEEQL
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgggggaccaccttgggaagagccagcatgctttactcaacgaaggggacgagaatgag
atggaaatatttggctatcggactcaaggctgtcggaaggctctttgtctcattggatcc
atcttttctcttggaatgctcccattggtattttattggagaccagcttggcgtgtatgg
gcaaactgtgtcccatgttccctgcaagaagcagacattgtgttgctgaggacaacagat
gaattcaaaatttattcttggaaaaaggtaatgtggatctccctgtcagcactgagcagc
acgtctggtctcactcctgaccaccctctcattgcagatgaggaatttatcataaacaga
gccatacgaaagccagacctaaaggtaagatacataaaagtgcagaaaatacgatatgtt
tggaataatttagaaggacagtttcaaaaaattggctctctggaagactgtctcagttca
gcaaagatacatcagaaatttggattaggcctgacttcagaggagcaggagatcaggagg
ctaatatgtggacctaacgctattgatgttgaaatcatacctatatggaagctgctcgtc
aaggaggttctaaatccattttacatctttcaactcttcagcgtctgtttgtggttcagt
gaagattacaaggaatatgctcttgccatcatcctcatgtctgtcatttccatagctttg
accgtgtatgacctcagacagcaatctgtaaaacttcaccatcttgttgaatcccataat
agcattacagtctctgtgtatgagcgaaaagctggagcccaagacctggaatcccgcctc
ctggtgcccggagatttattaatcctgacagggagcagagtgcaaatgccctgtgatgcc
gttctgattgatggcagctgtgtggtagatgaaggcatgctgacaggagaaagcattcct
gtcaccaaaaccccgctatcccagacggctagctctgcaccctggaagatgcagtctgaa
gcagatcctaggcggcacattctcttctgtggtacagaagtcatccaggccaaggcggcc
ggctctgggactgtgagagcagtggtcctgcagacggggttcaacactgcaaagggggac
cttgtgaggtctatcctgtaccccaagcccatgaacttcaagctctacagggatgccatc
agattccttctttgccttgtagggacggccaccattggcatgatctatactctgtgtgtc
tatgtgctcagtggggaaccccctgaggaggtggtgagaaaagccctggatgttatcacc
attgcagtccctcctgccctccctgccgccctgaccacaggcatcatctatgcccagagg
aggctgaaaaagaagggcatattctgcattagcccccagaggatcaatgtgtgtggacaa
ttaaaccttgtctgctttgacaagacaggcaccttaacgaggggaggcttggatctttgg
ggagttgtaccctgtgaccagaatggtttccaggcagtccacagctttgcctcaggcgag
gccgtaccctggggcccactgtgtgcagccatggccacctgccactccctgattcttctt
gatgggaccatccagggagaccctctggacctcaaaatgtttgaagccacccaatgggaa
atgactgtttctggggatgatttccacaacaaggaaatgctggcacacaccatggtagtg
aagccgccagacacagtgggccaggtcccagcggaagggctcgcgatcctccatcaattc
ccattctcatccgcactgcagaggatgacggtcatcgtccaggagacgggaggtggccga
atggcgttcatgaaaggtgcaccagagagagtggccagcttttgccaacctgacacagtg
ccaactacttttattagcgagctccaggtttatacgacacagggtttccgggtcatagct
ctggcctacaagaagctggaaacagactgtcccacaactaccttgatgagggagaaggtt
gaatcagacctgatatttctgggattgctgatcttggaaaatcggttgaaggaagagaca
aggcctgtgttagaggagctcatctctgctcggatacggactgccatgatcacaggcgac
aatcttcagactgcaataacagtggccaggaagtctgggatggtttccgaaggccagaaa
gtcattcttgttgaggcgaatgaagccactgattcttcatcagcatctatcacttggaag
ttagtggaagagaagaaacatggtctatttgggagtcaggacacctacatcaacatcaga
gaagaagtcccagaaaatggcagagaaggaaattaccattttgctctgagtggaaaatcc
ttccaggttataagccagcatttcagcagcttattgcccaagatactgatcaatgggacc
atctttgcaagaatgtctcctgggcagaagtcaagcctggtggaagaattccagaaactg
gactactttgtgggtatgtgtggagatggtgccaacgactgtggggctctgaagatggct
catgttggcgtctcgttatcagagcaggaggcatcggtggcctctcctttcacttccaaa
actccaaacatcgagtgtgtgccccatctcatcaaggaaggccgcgcagctctcgttacg
tccttttgcatgtttaagtacatggccctgtacagcatgattcagtatgttggtgttctg
ctgctctactggaaaacaaacagcctctcgaattaccagtttctattccaggatctggcc
atcacgactcttattggtgtaacaatgaatttgaatggtgccaacccgaagctagtgccc
ttcagacctgcgggaaggctgatctcaccacctctgctgctctcagttatcctcaacatc
cttctcagcttggctatgcacatcgtgggcttcatcctggtgcagaagcagccttggtat
tccatggactatcacagtgtctgtccagtgagaaatgagagtgtttcagccttatcagca
tctcccaacgttcctgagaaaaccagaagtaacagcacctttgcgagttttgagaatact
acaatatggtttttgggaacgatcaactgtatcgttgtggctcttgtattctctaaagga
aaaccatttaggcagcccacctatacaaactatatatttgtccttgtgctgattttacag
atgggcgtatgtcttttcattctatttgcggatatcccagagttgcataggcgtttggac
ctgctgtgcactcccgtcctgtggagagtctacattctcatcatggtcagctccaacttc
gttgtgtcccttgctgtggagaaggccattattgaaaaccgtgctctatggacagcggtc
aagagatgttttggttatcattcaaaaagccagtatcgggtatggcagaggaacctggcg
actgattcaagctggccccccctaaaccaaacctcctactctgatatgcagggggtgtcc
tacagcaaccctgtgtttgagagcaacgaggagcaactctga

DBGET integrated database retrieval system