KEGG   Rattus norvegicus (rat): 288038Help
Entry
288038            CDS       T01003                                 

Gene name
Meltf, Magea1, Mfi2
Definition
(RefSeq) melanotransferrin
  KO
K06569  melanoma-associated antigen p97
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    288038 (Meltf)
CD molecules [BR:rno04090]
 Proteins
  288038 (Meltf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 288038
NCBI-ProteinID: NP_001099342
RGD: 1308155
Ensembl: ENSRNOG00000001739
UniProt: D4ADK7
Position
11q22
AA seq 738 aa AA seqDB search
MRLLSVTFWLLLSLRTVLCVMEMQWCTISDPEQQKCKDMSKAFQGAGIQPSLLCVQGTST
DHCVQLIKDQKADAITLDGGAIYQAGKEYGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVT
INTLKGVKSCHTGINRTVGWNVPVGYLVETGHLSVMGCDVLKAVGDYFGGSCVPGAGETS
HSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGKALMSQDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRDDMDGGLIFRLLNEGQ
LLFSHEDSSFQMFSSKAYGQKNLLFKDSTLELVPIATQNYESWLGQEYLHAMKGLLCDPN
RLPHYLRWCVLSVPEIQKCGDMAVAFSRQSLKPEIQCVSAESPEHCMQQIQAGHIDAVTL
RGEDIYRAGKAYGLVPAAGELYAEEDRSNSYFVVAVVRRDSSYSFTLDELRSKRSCHPGL
GSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEK
GRNKCVGSSQERYYGYSGAFRCLVENAGDVAFLKHTTVFENTNGHNPEPWASHLRWQDYE
LLCPNGARAEVDQFQACNLAQMPSHAVMVHPDTNIFTVYGLLDKAQDLFGDDHNKNGFQM
FDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQCSGAGAAVHRVP
PPALLLLALAAGLLPRVL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcctgagcgtgactttttggctactcctgtccctgcgcactgtcctctgtgtg
atggagatgcagtggtgtaccatctcagacccggaacagcagaaatgcaaggacatgagc
aaggctttccagggagctggaattcagccctccctcctctgcgtccagggcacctccact
gaccactgcgtccagctcatcaaggaccaaaaagcggatgccatcaccctggatggagga
gccatctatcaggctggcaaggagtatggcctgaagccagtggtgggtgaagtctatgac
caagacattgggacttcctattatgcggtggctgtggtcaggaggaattccaatgtgacc
atcaacaccctgaagggcgtcaagtcctgccacactggcattaaccggactgtgggctgg
aatgtgcctgtcggctacctcgtagagactggccatctgtcagtgatgggctgcgatgtg
ctcaaagccgttggcgattattttgggggcagctgtgtccctggagcgggagaaaccagc
cattccgagtccctctgtcgcctctgccgtggtgactcttctgggcacaatgtgtgtgac
aagagtcccctagagagatactatgactacagcggagccttccggtgcctggcggaagga
gccggtgatgtggccttcgtgaagcacagcacagtgttggagaacactgatgggaaaacc
ctgccttcctggggcaaggccctgatgtcacaggacttccagctactctgcagggacggc
agccgggctgacattactgagtggagacgatgccacttggccaaggtgcctgctcatgct
gtggtggtcagggatgacatggacggaggcctcatattccggctgctcaacgaaggccag
cttctgttcagccatgaagacagcagcttccagatgttcagctccaaagcctacggccag
aagaacttgctgttcaaagactccaccctagagctcgtgcccattgccacacagaactat
gagtcctggctgggccaggaatacctgcatgccatgaaggggctgctctgtgatcccaac
cggctgccccactacctgcgctggtgtgtgttgtcggtgcccgagatccagaagtgtggc
gatatggctgtggccttcagccgccagagtctgaagccagagatccagtgtgtgtcagcc
gagtcccctgagcactgcatgcagcagatccaggctgggcacatcgatgctgtgactctg
aggggcgaagacatttacagggcaggaaaggcatatggcctggttccggcggctggggag
ctgtatgctgaggaggacaggagtaattcctactttgtggtggctgtggtgaggcgggac
agctcctactccttcaccctggatgagcttcgcagcaagcgttcctgccacccaggcttg
ggcagccctgcgggctgggaggtgcccataggctccctcatccagcggggcttcatccgg
cccaaggactgtgatgtgctcacagcggtgagcgagttcttcaatgccagctgtgtgcct
gtaaacaaccctaagaactacccctcctcactgtgcgcgctctgcgtgggagatgagaag
ggccgcaacaagtgtgtgggcagcagccaggagagatactacggctacagtggggccttc
aggtgccttgtggagaatgcaggggacgttgccttcctcaagcacacaactgtctttgag
aacacaaatggtcacaatcctgagccctgggcttctcacctcaggtggcaagactatgaa
ctactgtgccccaatggggcacgggctgaggtagaccagttccaagcttgcaacctggca
caaatgccatcccatgctgtcatggttcatccagacaccaacatcttcactgtgtacgga
cttctggacaaggcccaggacctatttggagacgaccacaacaagaacggtttccaaatg
tttgactcctccaaataccacagccaagatctgcttttcaaagatgctacggtccgagca
gtgcccgtccgggagaaaaccacgtatctggactggctgggtcctgactacgtggttgct
ctggaggggatgctatctcagcagtgctcgggtgcaggggccgcggtgcaccgagtcccc
ccaccggccctgctcctgctggccctggctgcaggcctcctcccgcgagttctctga

DBGET integrated database retrieval system