KEGG   Rattus norvegicus (rat): 288067Help
Entry
288067            CDS       T01003                                 

Gene name
Csta
Definition
(RefSeq) cystatin A (stefin A)
  KO
K13907  cystatin-A/B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    288067 (Csta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    288067 (Csta)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I25: cystatin family
   288067 (Csta)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   288067 (Csta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI
Motif
Other DBs
NCBI-GeneID: 288067
NCBI-ProteinID: NP_001099346
RGD: 1309603
Ensembl: ENSRNOG00000023953
UniProt: D3ZAJ1
Position
11q22
AA seq 97 aa AA seqDB search
MMPGGLTPARPATPEIQEIANEVKAQLEEQTNKKYEKFEAVEYKTQVVAGINYFIKMDVG
HDCFTHIKVFKGLSENSDLKLTGYQTNKTKNDELAYF
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctggaggcttgacaccggccagacctgctaccccagaaatccaggagattgct
aacgaggtcaaagcacagcttgaagagcaaaccaacaaaaaatatgaaaaattcgaagcc
gttgagtataaaactcaagttgtcgctggaatcaattacttcattaagatggatgtggga
catgattgtttcacccacataaaagtattcaagggtctttctgaaaacagtgatttgaaa
ctgactggttaccagactaacaaaaccaagaatgatgaactggcctacttctaa

DBGET integrated database retrieval system