KEGG   Rattus norvegicus (rat): 288111Help
Entry
288111            CDS       T01003                                 

Gene name
Spice1, Ccdc52, RGD1310729
Definition
(RefSeq) spindle and centriole associated protein 1
  KO
K16490  spindle and centriole-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    288111 (Spice1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    288111 (Spice1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPICE Herpes_UL74 JIP_LZII
Motif
Other DBs
NCBI-GeneID: 288111
NCBI-ProteinID: NP_001008286
RGD: 1310729
Ensembl: ENSRNOG00000039024
UniProt: Q5RKG1
Position
11q21
AA seq 868 aa AA seqDB search
MSLIRVNRFGPRGGARKTLKVKKKAAVRQEWDNTVNDLTVHRATPEDLVRRHEMHKSKNR
ALVHWELQEKALKRKWKKQKPETSSIEKRKLSIMKEILSDQYQTQDVLEKSDHLLTAAKG
LFVDVPRKRTGFPNVTMAPGSSRSPAGINQDPGTQSILNESIIEPQALNEVDDGGAESTA
HSQSEDSESELPNSLSPHSNRNTERFLHQLKEENSELINQLWTDIQQKIAAQSQRTPPGS
PSSELSAEDQKGALNATDAVKRIQAGLQPEESAEPVDSSYVGQVLNTRKPKPLLSKVKRK
QDMRALSKQKKNMLSSSTTSADLASSNNSSLDVLKHMIHEVEHEMEEYERWTGREVKGLQ
GGQGLTGFTLSLVSSLCRLVRYLKESETQLRKEVETRQQLEQMLGDHRELIDALTAEILL
LREENGAVQARLQQYMVTTDEQLISLTHAIKSCPVINNSRQESQAPERAAMGRRLVDNVG
APVVNSNVSMPLMLKGEEMVDFPQEELPVKLSQGPPPTENLNLASNFPTHIFEPAVMLTP
PRQKSNSEFSPLQDVLRRTVQTRPAPRIPPTVEVIEKEQTWEKKNLPIDPDIQNSSEESR
LFTQRWRVSHMGDDLENKSQPQFVSLSQPPQFVSLSQPPCSSPPSTQQSRNPVFSEEPTV
LGDGQQLGTADALMHRKDIMARIAELTLQNSAMKAHLNNITSSGGEHGDGLREPSRQGNA
SEVPANFPAVQSLMPSSMEERIAELNRQSMEARSKLLQLIEQQKLVGLTLSSSPVSPVES
PLRAWTEEGKRTIEVSVPGVEASESSKCNTVSPVSGVSSRRSSGAISNSCSPLNATSGSG
KFTPVNPRTKQTEKQSEEGWFALSAHLP
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgatcagagtgaaccgctttggtccccggggaggtgcaagaaagactctgaaa
gtaaagaagaaagctgcagtgaggcaagagtgggataatactgtgaatgatctaacagtt
caccgggcaactcctgaagatctggtgcgccgtcatgagatgcacaagtcaaagaataga
gcattggtgcactgggaacttcaagaaaaagctttgaagagaaaatggaagaagcagaaa
ccagaaacctcaagtattgaaaaaagaaagttatctatcatgaaggagattctttctgat
cagtaccagacacaggatgtgctggaaaagtctgatcatctgctgactgcagccaaaggt
ctgtttgttgatgttcctcgtaagcgcacagggtttccaaacgtaacaatggctccaggc
tcctcacggagccccgctggaataaatcaagaccctggcacccagtctatccttaacgaa
tcaatcatagagcctcaggctcttaatgaagtagacgatggaggggcggaaagcactgct
catagccagtcagaagacagtgagagcgaactgcctaactccctcagcccacactccaac
aggaatacagagaggtttcttcaccagctaaaggaagaaaattctgagttaatcaatcaa
ctgtggactgatattcagcagaagatcgctgcccagtcacaaagaactcctccaggctct
ccgtcctcggagctttcagcagaggatcagaaaggtgctctgaatgcaacagatgctgtc
aagagaatccaggctgggcttcagcctgaggagtctgctgaacctgtagactccagctat
gtggggcaggtgctgaacacaaggaagccaaagccgctgctaagcaaagtgaaaagaaaa
caagatatgcgtgctctctccaagcagaagaaaaacatgctctcctccagcacaacctct
gcagacttagcaagtagcaataattccagcctggatgtcctcaaacacatgatccatgag
gtggaacatgaaatggaagagtatgagcggtggacaggccgtgaggtcaaggggctgcag
ggtggtcagggactcacaggcttcactctgtccctggtgagctcgctctgccggctggtt
cggtaccttaaagagagtgaaacccaacttcggaaagaagtagagacaaggcagcagctg
gaacagatgttaggtgatcaccgagagctcattgatgcgctgacagctgaaattcttctc
ctcagagaggaaaatggtgccgtgcaggcgagacttcagcagtacatggttactacagat
gagcagcttatatcgctcacacatgccattaagagctgtcctgtgatcaataactccaga
caagaaagtcaagcaccagaaagggcagctatgggtagaagacttgtggataatgtaggg
gctcctgtggtaaacagtaatgtctccatgccgttgatgctcaaaggggaggaaatggtt
gacttcccacaggaagagctgcctgttaaactatctcaggggccaccccccacagaaaac
ttgaatctggccagtaacttcccgacacatatttttgagccagccgtgatgctcacacca
cccaggcagaagagcaactcggaattctctcctctgcaggacgtactgaggagaactgtt
cagactcgtccagctccacgaattcctcccactgtggaagttatagagaaggaacagacc
tgggaaaagaagaacctgcctattgatccagacattcagaactcaagtgaggaaagccgt
ctcttcactcagaggtggagagtctctcacatgggagacgacttagagaacaaaagccag
ccacagtttgttagcctgtcacagcccccacagtttgttagcctgtcacagcccccttgc
agttcccctcccagcactcagcaatcgagaaaccccgtgttctcagaggagcccacagtg
cttggagatgggcagcagctcggaacagctgacgcactgatgcacaggaaggacataatg
gcccggatcgctgagctgacactgcagaattcagccatgaaggcgcacctgaacaatatt
accagctcagggggagagcacggcgatggactccgggagccgagcagacagggaaatgcc
agcgaagtgcctgcaaatttcccagcagttcagtctctgatgccaagcagcatggaggag
aggattgcagagctgaaccgacagagcatggaggctcgcagcaaactgctccagttgata
gagcagcagaaacttgttggtttgaccctttcctcgtcaccagtgtcacctgttgagtca
cctctcagagcttggactgaggaaggaaagcgaaccatcgaggtatctgtcccaggagtg
gaggcttccgagagttcgaagtgcaatactgtgtctcccgtcagtggggtcagttccaga
agatcgtcaggggcgattagcaattcctgttctccactgaacgccacctcgggaagtggg
aagttcacgccagttaatccaagaacaaagcagactgagaagcaaagtgaggaaggctgg
tttgctctttctgcccacttaccgtaa

DBGET integrated database retrieval system