KEGG   Rattus norvegicus (rat): 288117
Entry
288117            CDS       T01003                                 

Gene name
Slc9c1, Gm610, Slc9a10
Definition
(RefSeq) solute carrier family 9 member C1
  KO
K14726  solute carrier family 9 (sodium/hydrogen exchanger), member 10/11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    288117 (Slc9c1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   288117 (Slc9c1)
SSDB
Motif
Pfam: Na_H_Exchanger cNMP_binding OGG_N Ubiq_cyt_C_chap zinc_ribbon_6
Other DBs
NCBI-GeneID: 288117
NCBI-ProteinID: NP_001008762
RGD: 1309075
Ensembl: ENSRNOG00000022007
UniProt: A0A0G2K3D4
Position
11q21
AA seq 1181 aa
MEEVFENLTTTHNVKLSNAWLDLLKSVFLSTPQDLPEIILILSLICTIGAFLNMHLKDFP
IPLPVILFLIGCCFEILSFASTQIQLYADAIQWMDPDMFFGIFTPVIIFNVAFDMDIYML
QKLFWQILLITIPGFMINYTLILWYLQSVNKLSLKTIPWLLFSAVLISSDPMLTSASIRD
LGLSRSLTNLINGESLLTSVISLIIYSAVVQISFKSKHMNHTLAHKVMSTAWSYLVESFI
TGILITKAIQLWMATIFGDDVNHITLIFSVLYLIFYVCELIGMSGIFTLATIGLFLNSTS
FKPGVEAFLLEFWNCLSFIGFLMVFTFIGLLIPAHTYLYISFSDVYYSLNIYFTLIVLRL
LVFLLMSPILSRLGHGFSWRWAFIMVWSEMKGTPNINMALLLAYSDVSLGSERERSQILF
HGVSVCVITLIVNRFILPMAVIKLGLRDVTSTKYKSVYYTFQHFQELTKSTAMALKFDKD
LANADWNMVDKAIILQNPYALNQEETTEHQKVKCPDCNKEIDETLNIEAMELANRRLLSA
QIASYQRQYRNEILSQSAMQVLVGAAGSFGEKKGEYMSPENIKNYSESKKLLSFLRKLLL
NWVYNTKKDKGVPSRYMFLHACHSIVFTNEFEYTGYIAVLMNTYPMIICWISRLKDIYQY
EIKCANYYFLTFYILEALLKVAAMRKEFFSHTWLLFELGITLVGILDIILIETDSISYKF
DLTETVVFMNVVRLLRILRILKLITPKLLQVIDKRMSQQISFRYAILKGYVQGEMDVLNI
IDQIASSKQAKQILLKRVIRNMDHAMKELGYLEYDHPEIAVTMKTKEEVNVMLNMAREIV
KAFRSKGIIHKVEGAEINKLIMAKKKQVLELQSVIQPLNVEEAPYYIPWLSEDPEAISFI
QEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSSESEVAQTRSYT
LPHTEYLLSGEIIGELNCLTKERMQYSATCKTVVETYFIPISHLYEGFEKKYPNMKYKMW
QKIGLAITAQKIRENLSFEDWNYKMQLKLCNVFVRDIPKTTKTDIYDETVTHVVLIHGSA
EDCQLRKIYKAPFLIPVTCHQIQGLEEFTKVMIIQTSVAVRKFRWNVKKYNPPRRISMKP
DSTESLETLNESSEDDEDKKENEENEEYLEDIIDISSVSKK
NT seq 3546 nt   +upstreamnt  +downstreamnt
atggaagaagtttttgagaatctaactacaacccacaatgtcaaactgagtaatgcatgg
ctggatcttctcaaaagcgtgtttttgagcactccccaggacctccctgaaatcatcttg
atactatctttgatctgtacgattggagcatttttgaacatgcatctgaaggattttcca
attcctcttcctgtgatactatttttaattggatgctgttttgaaattctgagttttgca
tctactcagatccagttatatgcagatgccatacagtggatggatcctgacatgtttttt
gggatatttacaccagtaattatctttaatgttgcatttgacatggatatatacatgctt
caaaagttattttggcagatattattaattacaattcctggatttatgattaattacacc
ttaatactgtggtatctgcagtctgtgaataaattatctttaaagaccatcccctggcta
ctgttttcagctgtgcttatcagttcagatcctatgcttacttcagcctccataagagac
cttggtctttccagaagcctcacaaatttaattaacggagagagtctactgacctcagtg
atatccttaattatatatagtgctgttgtgcagatcagtttcaagtcaaagcatatgaac
cataccctagcccataaggtcatgtccacagcttggtcatatcttgtggaaagtttcatc
actggaatcctaattacaaaagcgattcagttatggatggctaccatctttggtgatgac
gtcaaccacatcacgctcatcttctcagttctatacctcatcttctatgtttgtgagcta
attggaatgtctggaatatttactctggccaccataggactttttctaaattctacaagt
tttaaaccaggagttgaagcatttctcctcgaattctggaactgcctgtcctttattggt
ttccttatggtgttcactttcattggacttctaatccctgcacacacatatttatatata
tcattttctgatgtgtattactcattaaatatctacttcacgctgattgttttaaggctt
ctggtctttctgctaatgagccccattttgtctcgacttggtcacgggttcagctggcgc
tgggcgttcatcatggtctggagtgaaatgaaaggaacaccgaacataaatatggccctt
ctgcttgcctactcggacgtttctcttggttccgagagggaaagatctcaaatattattc
catggcgtgtcagtatgtgtaatcaccctgattgtcaatagatttattttgccaatggca
gtaattaaactaggtcttcgtgatgtcacatcaacaaaatataaatcggtttattataca
ttccagcactttcaagagctaaccaaatccacagccatggcactcaaatttgacaaagat
cttgctaacgctgactggaacatggttgacaaggcgattatacttcaaaatccatatgct
ttaaaccaagaagaaacaacggaacatcagaaggtgaaatgtcctgattgcaacaaggaa
atagatgagacccttaacattgaagccatggagttggccaacaggcgtctcctgtcagcg
caaatagcaagctaccaacgacagtacaggaatgagattctgtcccagagtgcaatgcaa
gtgttggtaggcgcggccggaagctttggtgagaagaagggagaatatatgagtcctgag
aacataaagaattattcagaaagcaaaaaactcctctcctttcttagaaaattactactc
aactgggtatataatactaaaaaagataaaggggttccatcaagatacatgtttcttcat
gcatgccatagcatagtcttcacaaatgaatttgaatacactggatacatcgctgtatta
atgaacacatatccgatgataatctgttggatttcccgactaaaagacatctatcaatat
gagataaaatgtgctaactactattttcttacattttatattctagaggctctacttaag
gtggcagcaatgaggaaggaatttttttcacacacctggctcctgtttgagctcgggatt
accttggtcggcatcctagatataatacttatcgaaacagactccattagttacaaattt
gacttaactgagactgtggtcttcatgaacgtggttcgactccttcgtatactgcgcatc
ttgaagcttataacaccaaaattgctgcaagtaatagacaaaaggatgagccagcagata
tccttccggtatgctatactaaaaggctacgtccaaggggaaatggatgtactgaatata
attgatcagattgcaagttccaaacaggctaaacagatattgttaaagcgagtaataagg
aatatggatcatgctatgaaagagctgggctacctagagtatgatcacccagaaatcgct
gtcactatgaaaaccaaggaggaggttaatgtgatgctcaatatggccagagaaattgtc
aaggctttcaggtccaaaggaattatacataaggtggaaggcgctgagatcaacaagtta
atcatggccaaaaagaaacaagtgcttgagctgcagtctgttatccagccacttaatgtt
gaagaagccccatactatatcccatggctcagtgaagatcctgaagccataagctttatt
caggaaaaagcaaaagttgtgacatttgactgcggaaataacatatttgaggaaggcgac
gaaccagaaggaatctatgtaataatttcgggcatggtaaagcttaaaaggtcaaagcca
cacctggagatggatagagtgtcctcagagtcagaggttgctcagactagaagttataca
ctgcctcacacagaatatctgctcagcggggaaataataggagagttaaactgtttgact
aaagaacggatgcaatattctgccacctgcaaaactgttgtggagacgtattttattccc
attagccacttgtatgaaggctttgaaaaaaaataccctaacatgaaatataaaatgtgg
caaaaaatcggacttgccattactgcccaaaagatccgggaaaacttatcttttgaggac
tggaactacaagatgcagttgaaactctgcaatgtcttcgtaagggacatacccaagacc
acaaaaactgacatctatgatgaaacggtaacccatgttgtcctcatccatggatctgca
gaagactgccagttgcgaaaaatttataaggcacctttcctaattcccgtgacatgccat
cagatacaaggcttagaagagttcacaaaagtcatgattattcaaacttccgttgctgtg
agaaaattcaggtggaatgtaaaaaagtacaacccacctcgaaggatttcaatgaaacca
gattctacagaatcacttgaaacattaaatgaaagttctgaagatgatgaggataaaaaa
gagaatgaagaaaatgaggaatatttggaagatattattgacatctcaagtgtctccaag
aaataa

DBGET integrated database retrieval system