KEGG   Rattus norvegicus (rat): 288153Help
Entry
288153            CDS       T01003                                 

Gene name
Hoxd4
Definition
(RefSeq) homeo box D4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288153 (Hoxd4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    288153 (Hoxd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Herpes_pp85 Homeobox_KN DUF2209 DGF-1_C
Motif
Other DBs
NCBI-GeneID: 288153
NCBI-ProteinID: NP_001099355
RGD: 1309690
Ensembl: ENSRNOG00000001578
UniProt: D4ACE1
Position
3q23
AA seq 251 aa AA seqDB search
MAMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPPGLYPRPDFGEQ
PFGGGGPGPGSALPARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACSQPTGPKQPP
PGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRR
RRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSCSSSAAPSQHLQPM
AKDHHTDLTTL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccatgagttcgtatatggtgaactctaagtacgtggaccccaagtttcctccgtgc
gaggaatatttgcagggtggctacctaggcgagcagggagccgactactacggcagcggt
gcacagggctccgacttccagcccccggggctctacccacggcccgacttcggtgagcaa
cccttcggaggcggcgggcccgggcctggctcagcgctgcccgcgcggggtcacggacag
gagccgagcggcccgggaagtcactacagtgccccgggagagccgtgcccagcgcccccg
cctgcgcccctgcctggcgctcgggcctgcagccagcccaccggccccaagcagccgccc
cccgggacagcactcaagcagcccgctgtggtctacccttggatgaagaaggtgcatgtg
aattcggtgaaccccaactacaccggcggggagcccaagcgttcccggacggcctacacc
agacagcaagtcctagaactggaaaaggaatttcattttaacaggtatctgaccaggcgc
cgtcggattgaaatcgctcacaccctgtgtctttctgagcgccagatcaagatctggttc
cagaaccggaggatgaagtggaaaaaagatcacaaactgcccaacaccaagggcagatct
tcttcttcctcatcttcctgctcctcttcagctgcccccagccagcatttgcagccaatg
gccaaggaccaccatacggacctgacgaccttatag

DBGET integrated database retrieval system