KEGG   Rattus norvegicus (rat): 288154
Entry
288154            CDS       T01003                                 

Gene name
Hoxd13
Definition
(RefSeq) homeo box D13
  KO
K09298  homeobox protein HoxA/C/D13
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288154 (Hoxd13)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    288154 (Hoxd13)
SSDB
Motif
Pfam: Homeodomain HoxA13_N Homeobox_KN OMP_b-brl
Other DBs
NCBI-GeneID: 288154
NCBI-ProteinID: NP_001099356
RGD: 1308417
Ensembl: ENSRNOG00000001588
UniProt: D4ACD0
Position
3q23
AA seq 331 aa
MDGLRADGGAAGAAPASSSSSVAAPGQCRGFLSAPVFAGTHSGRAAAAAAAAAAAAAAAS
SFAYPGTSERTGSSSSSSSSAVIATRPEAPVAKECPAPAAAATAAAPPGAPALGYGYHFG
NGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYMDVSGLASSSVPTNEVPARAKEVSF
YQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCAKDQPQGS
HFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRISAA
TNLSERQVTIWFQNRRVKDKKIVSKLKDTVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atggatgggctgcgggcggacggcggggccgctggggcggcaccggcctcctcctcctcc
tctgtggcggcgcctggccagtgtcgcggcttcctgtcggcgccggtgttcgcggggaca
cattccggacgcgcggcggccgcagcggcagcggcggcggcggcggcggcggcagcctcc
agcttcgcgtacccagggacctctgagcgcacaggctcgtcgtcgtcgtcgtcatcctcg
gctgtgatcgccactcgccccgaggctccagtggccaaagagtgtcccgcgccagcggcc
gcggcgaccgcagcagcaccgccgggcgctcccgcgttgggctatggctaccatttcggc
aacggctactacagctgccgcatgtcgcacggcgtgggcttacagcagaacgctctcaag
tcgtccccgcacgcctctctcggaggtttcccagtggagaagtacatggacgtgtcgggc
ctggcgagcagcagcgtaccgaccaacgaggtgcccgcgcgagccaaggaagtgtccttc
taccagggctacacgagtccctatcagcacgtgcctgggtatatcgacatggtgtccact
tttggatccggggaacctcggcacgaggcgtacatttccatggagggctaccagtcctgg
acgctagccaacgggtggaacagccaggtgtattgtgccaaggaccagccgcaggggtcc
catttttggaaatcatcctttccaggggatgtggctttaaaccagccggacatgtgcgtc
taccgtcggggaaggaagaaaagggtaccttataccaaactgcagctcaaagaactggag
aacgagtatgccattaacaagtttattaacaaggacaagcggcggcggatctcagctgcc
accaacctatccgagagacaagtcaccatttggtttcagaatcgaagagtgaaggacaag
aaaatcgtctccaagctcaaagatactgtctcctga

DBGET integrated database retrieval system