KEGG   Rattus norvegicus (rat): 288161
Entry
288161            CDS       T01003                                 

Gene name
B3galt5
Definition
(RefSeq) Beta-1,3-galactosyltransferase 5
  KO
K03877  beta-1,3-galactosyltransferase 5 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno01100  Metabolic pathways
Module
rno_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    288161 (B3galt5)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    288161 (B3galt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    288161 (B3galt5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     288161 (B3galt5)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 1 chain
   288161 (B3galt5)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 288161
NCBI-ProteinID: NP_001099357
RGD: 1306727
Ensembl: ENSRNOG00000030983
UniProt: D4AB20
Position
11q11
AA seq 308 aa
MAHMKTRLLYASVLTMGALCLYFSMESFQELPFVFKKSHGKFLQLPEIDCKQKPPFLVLL
VTSSHKQLAARMAIRKTWGRETSVQGQPVRTFFLLGSSDSTEDMDATALESEQHRDIIQK
DFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTG
YIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLE
DVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALETS
KDEDCPAV
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcccacatgaagacgaggctcctttatgcttccgttctcacgatgggtgcgctctgc
ttgtacttcagcatggagtctttccaagaactcccctttgtcttcaagaaaagtcacggg
aagttccttcagcttccggagatagactgcaagcagaagccgcctttcctggtgctgctg
gtgacgtcatcccacaagcagctggcggctcgcatggccatccgcaagacgtggggtaga
gagacatcggtgcagggccaacccgtgaggaccttcttccttctggggtcctcagacagc
acggaggacatggacgctacagccctggagagcgagcagcaccgtgacatcatccagaag
gatttcaaggacgcctatttcaacttgaccctgaagaccatgatgggtatggaatgggtc
taccacttttgccctcagaccgcttatgtgatgaaaacggactcagacatgtttgtgaat
gttggctatctgaccgaactgctgctaaagaaaaacaaaacaaccaggttcttcacaggc
tacataaagccccacgactttcccatcaggcagaagttcaacaagtggtttgtcagtaag
ttcgagtacccctgggacaggtacccaccgttttgctctggtactggttatgtcttttcc
agcgacgtggcgatccaagtatacaatgtctcagagagcgttccattcatcaagctggag
gatgtgtttgttgggctctgcctggccaagctgaagatccgacctgaggagctccacacc
aagcagaccttcttccccggtggtttacgcttctctgtgtgccgctttcagaaaattgtg
gcgtgccattttatgaagccccaggacctgctcacttactggcaggcactggagacctcg
aaagacgaggactgtcctgcggtctga

DBGET integrated database retrieval system