KEGG   Rattus norvegicus (rat): 288176Help
Entry
288176            CDS       T01003                                 

Gene name
Cmss1, RGD1309437
Definition
(RefSeq) cms1 ribosomal small subunit homolog (yeast)
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CMS1 DEAD SPK
Motif
Other DBs
NCBI-GeneID: 288176
NCBI-ProteinID: NP_001013888
RGD: 1309437
Ensembl: ENSRNOG00000027888
UniProt: Q5FVR6
Position
11q12
AA seq 276 aa AA seqDB search
MADDLGDEWWENQPATAGSPELSGGEEGGDTEMTQKDTVPVPEKTKQPTECFLSQVKEPK
TEDSRKSRKWKKKKISDILAKSEPKPGTPEDLQKLIKGHYSSSRSVIELEELHLPDSCFL
KCNDLTHSLSSYLKEICPKWVKLRKTHNEKKSVLMLILCSSAVRALELIRSLTAFKGDAK
VMKLFAKHIKVQEQVKLLEKRAIHLGVGTPGRIKELVKQDGLNLNPLKFLVFDWNWRDQK
LRRMMDIPEIRKEVFELLDMGVFSLCKSDSLKLGLF
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgatctgggagacgagtggtgggagaaccagccggccacggccggcagccca
gagctgtcaggtggagaggaaggaggagacacggaaatgacacagaaggacacagttccg
gttcctgagaaaaccaaacagcccactgagtgtttcctgtcacaggtgaaggaaccaaaa
acagaggactcccggaagagcaggaagtggaagaagaagaaaatttctgatattcttgca
aaatcagagcccaaaccagggacccctgaagaccttcagaagctgatcaagggccattac
agcagcagccgttctgtgattgaattagaggaactgcacctaccagactcctgcttcctc
aagtgcaatgacttgactcacagtctctcttcatacctaaaagaaatctgccctaagtgg
gtaaaacttcggaaaacccacaatgagaaaaagtcggtcctgatgctgatcctgtgcagc
tccgctgtccgggccctggagcttatcaggtctctgacagcattcaaaggagatgccaaa
gttatgaaattatttgcaaaacacataaaggtccaggagcaggtgaagttgctggagaag
cgagcgatacacctgggcgtggggactccagggagaatcaaagaacttgtcaaacaagat
ggccttaatttgaaccccttaaagtttctggtttttgactggaactggagagatcagaag
ctgaggagaatgatggacattcccgagataagaaaggaggtttttgagcttctagatatg
ggagtgttcagcctatgcaaatcggactccttgaagctgggccttttctga

DBGET integrated database retrieval system