KEGG   Rattus norvegicus (rat): 288238Help
Entry
288238            CDS       T01003                                 

Gene name
Pigp, Dscr5
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class P
  KO
K03861  phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
rno01100  Metabolic pathways
Module
rno_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    288238 (Pigp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-P DPM2 Phage_holin_3_6 SieB
Motif
Other DBs
NCBI-GeneID: 288238
NCBI-ProteinID: NP_001093228
RGD: 1307205
Ensembl: ENSRNOG00000039850
UniProt: B2GUT8
Position
11q11
AA seq 132 aa AA seqDB search
MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPV
YLLITVVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQRKSYQEDAIPALRDIPISEVN
RMFFLDAKELNT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaaattcaccgtcgccattgccagaaagagcgatttatggctttgttcttttc
ctaagctctcagtttggcttcatactctatcttgtgtgggctttcgttcccgaatcttgg
ctaaactccttaggcttaacttactggcctcaaaagtactgggcagttgcgttgcctgtc
tatctcttgatcacggttgtaattggttacgtgctcttatttggaatcaacatgatgagt
acctctccacttgactccatccatacgatcacagataactatgctaaaaaccaacagagg
aaaagctaccaagaggacgccatcccagcattaagagacattcccattagtgaagtcaac
agaatgttcttcctagacgccaaagaactcaacacctaa

DBGET integrated database retrieval system