KEGG   Rattus norvegicus (rat): 288264Help
Entry
288264            CDS       T01003                                 

Gene name
Ifnar1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    288264 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    288264 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    288264 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    288264 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    288264 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    288264 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    288264 (Ifnar1)
  09158 Development
   04380 Osteoclast differentiation
    288264 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    288264 (Ifnar1)
  09172 Infectious disease: viral
   05162 Measles
    288264 (Ifnar1)
   05164 Influenza A
    288264 (Ifnar1)
   05161 Hepatitis B
    288264 (Ifnar1)
   05160 Hepatitis C
    288264 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    288264 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    288264 (Ifnar1)
   05169 Epstein-Barr virus infection
    288264 (Ifnar1)
   05165 Human papillomavirus infection
    288264 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    288264 (Ifnar1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IFN receptor family
   288264 (Ifnar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3
Motif
Other DBs
NCBI-GeneID: 288264
NCBI-ProteinID: NP_001099363
RGD: 1305399
Ensembl: ENSRNOG00000028594
UniProt: D3ZDS9
Position
11q11
AA seq 593 aa AA seqDB search
MLAVVGAAALVLVAGAPWMLPVASGEDNLRPPEDVAIYIIDDNYTLKWNHHRESMGNVTF
SAEYQKGEGRIWLKVPKCQHITRTKCEFSLLGINVYSKTQFRVRAEEGNSTSSWNEADSF
IPFYKAHVSPPRVHLKAEDKAILVYISPPGEDGTMWAQEKRCFNYTIRIWGRSFPVREIK
PMYFPKKISKLLPETTYCLEVRAVHTSLQRHSNYSSARCINTTVANKIPVPENLEVDVQG
DSYVLKWDHAFANMTFKAQWIPVYSKSSPGNHSDKWKPIPTCANVQTTHCVSPRETFHTG
TFFLRVQASDGNNTSFWSEEKLIDSQKYTLLPPPVIAVTPTGDSLLVYVSCKDSKCNGLI
YEVIFWENTSNTEKRQHPQSMIKEHPEFNVVNLRPLTVYCVQARVLSTGVWNKTSKFSDK
LCKKTHPGNSSVTWIITGFGALLFSAMAFYAGRSLQKYLYYVFSPPLKPPCSIDEFFSEL
PSKSLLLLTAEEHTERCFVIENTGVVAGEENRAPEEELRKYSSQSSQDSGNYSNEEEESV
GPESGQDMLSTAPSGSPWSLPCPAGTLEDGACFPGKEKHLQSPVLRTQPALHG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgtcgtaggcgctgcggccctggtgctggtggcaggggcgccttggatgctg
cccgtagcctcaggtgaagacaatctaaggcctcctgaggatgtagccatctacattata
gacgacaactataccctaaagtggaaccaccacagagaatcaatgggcaacgtgactttt
tcagcagaatatcaaaaaggagaaggaaggatctggttaaaagtgcccaaatgtcaacat
attacaaggaccaaatgtgaattctctttactgggcataaatgtttacagcaagacacag
tttcgtgtaagagcagaagaagggaatagcacttcttcatggaatgaggctgattcattt
attccattctacaaagctcacgtcagccccccaagagtacatttaaaagctgaagataaa
gccatactagtctacatctctcctcccggagaagacggaaccatgtgggcacaggagaaa
cgctgcttcaattacacgatacggatctgggggaggtcttttcctgtcagagaaattaaa
cctatgtattttccaaaaaagatatcaaagctcttgccagagactacctactgtttagaa
gtcagagcagtgcacacatcgcttcagagacacagcaactatagctcagcgcggtgtata
aacaccacagtggcaaataaaatacctgtgccagaaaatctagaagtggatgtccaaggt
gacagctatgttctgaaatgggaccacgcatttgcaaacatgaccttcaaagcacagtgg
atccctgtctattcaaaaagtagtcctggaaaccattcagacaaatggaaaccaatacct
acctgtgcaaatgtgcagactacacactgtgtatctcctcgagagactttccacacagga
actttctttctccgtgtacaagcctcagatggaaataacacgtccttttggtctgaagag
aaacttattgattctcaaaaatacactctccttcctcctccggtcattgctgtcaccccc
acgggggactccttgcttgtttatgtcagctgtaaggacagcaaatgtaatggactcatt
tacgaagtcatcttttgggaaaacacttccaatactgagaaaagacaacacccacaaagc
atgattaaagaacacccagagttcaacgttgtgaacctgcggccgctgactgtgtactgt
gtccaggctagagtgctctccactggcgtgtggaataagaccagtaaattcagtgataag
ctgtgtaagaaaacacatccaggaaactcttctgtgacctggattataactggatttggt
gctctactcttctctgccatggccttttatgctgggaggagcctccaaaaatacctgtat
tacgtgttctccccaccactcaagcctccctgcagtatcgacgagtttttctcagagctg
ccttccaaaagccttctgcttctgactgctgaagagcacaccgagaggtgcttcgtcatt
gagaacacaggtgtggttgctggagaggagaatcgcgcacctgaggaggagctcaggaag
tacagttcccagagcagccaggactcagggaactactccaacgaagaggaggagagtgtg
gggcctgagagtggccaggatatgctttccacagctcccagtgggtctccatggagcctg
ccctgccctgctggcaccttggaagatggtgcctgcttcccgggaaaagaaaagcacctt
cagagcccagtcctgaggacacagccagctctccacggctga

DBGET integrated database retrieval system