KEGG   Rattus norvegicus (rat): 288272Help
Entry
288272            CDS       T01003                                 

Gene name
Mis18a, RGD1310778
Definition
(RefSeq) MIS18 kinetochore protein A
  KO
K11564  kinetochore protein Mis18
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    288272 (Mis18a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     288272 (Mis18a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Yippee-Mis18
Motif
Other DBs
NCBI-GeneID: 288272
NCBI-ProteinID: NP_001120995
RGD: 1310778
Ensembl: ENSRNOG00000021555
UniProt: B2RZC4
Position
11q11
AA seq 223 aa AA seqDB search
MAGTFSLEPCSTSSSCNHQGKRSESSLLEKRLSEDSSRHWRLQKWASMSSADASRTLLER
REEKAAAAENPLVFLCTRCRRPLGDSLTWVASQEDTNCILLRSVSSNVSVDKEQKLSKCR
DEDGCILETLYCSGCSLSLGYVYRCTPKNLDYKRNLFCLSVEAVESYTLGSSEQQIVSEE
EFFNLESRVEIEKSIKQMEDVLTVMQAKLWEVESKLSKAGRYS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctggtacattttctctggaaccctgctctacctctagttcgtgtaaccaccagggc
aagcggagcgagtcttcgctgctggagaagcggctgtcggaagattcgagccgccattgg
cggctgcagaagtgggcgagcatgtcgagcgcagacgcgtcgaggacactgctggagagg
cgtgaggagaaggctgccgcggcggagaacccgctggtgttcctgtgtacgcgctgtcgc
cggccgctgggcgactcgctcacctgggtggctagccaggaggacaccaactgcatcctg
ttgcgcagtgtctcctctaacgtctctgtggataaggaacagaaactgtccaagtgcaga
gatgaagatggttgcatccttgagacgttgtactgttcaggctgctccctcagccttggc
tatgtgtacagatgcactcccaagaacctggattacaagaggaacttgttctgcctcagc
gttgaagccgttgaaagttataccttagggtcctctgaacagcaaatcgtgtcagaagag
gaatttttcaatcttgaaagcagagttgaaatagagaagtctataaagcagatggaggac
gtcctgacagtcatgcaagcgaagctgtgggaggtggaatcaaaactgtccaaggctggc
cggtacagctga

DBGET integrated database retrieval system