KEGG   Rattus norvegicus (rat): 288305
Entry
288305            CDS       T01003                                 

Gene name
Cct8
Definition
(RefSeq) chaperonin containing TCP1 subunit 8
  KO
K09500  T-complex protein 1 subunit theta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    288305 (Cct8)
   03036 Chromosome and associated proteins [BR:rno03036]
    288305 (Cct8)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP60 / Chaperonin
   288305 (Cct8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    288305 (Cct8)
SSDB
Motif
Pfam: Cpn60_TCP1 DUF2095
Other DBs
NCBI-GeneID: 288305
NCBI-ProteinID: NP_001099367
RGD: 1305452
Ensembl: ENSRNOG00000001592
UniProt: D4ACB8
Position
11q11
AA seq 548 aa
MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRL
EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
IGLSVSEVITGYEIACKKAHEILPDLVCCSAKNLRDVDEVSSLLRTSIMSKQYGSEEFLA
KLISQACVSIFPDSGNFNVDNIRVCKILGSGVYSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADM
ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVLEEMGHCDSVYLSEVGDTQV
VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGL
DIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
DWDDDQND
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcgcttcacgtccccaaggccccgggctttgcccagatgctcaaagatggagcaaaa
catttctcaggattagaagaggctgtgtatagaaatatacaggcttgcaaggagctggcc
cagaccacccgtacagcatatggaccaaatggaatgaataaaatggtgattaatcgcctg
gagaagttgtttgtgaccaacgatgcagcgactattttaagagagctagaagtgcagcat
cctgctgccaagatgattgtgatggcctctcatatgcaagaacaagaggttggcgatggc
acaaactttgttctggtattcgctggcgctcttctggaactagctgaagaacttctgagg
attggcctgtcagtatcagaggtaataacagggtatgaaatagcttgcaaaaaagctcat
gagattcttcctgatttggtgtgttgttctgccaaaaacctgcgagatgttgatgaggtg
tcgtcgctgctgcgcacctccataatgagtaagcagtacggcagcgaggagtttctggcc
aagctcatttctcaggcgtgtgtatctatttttcctgattctggcaatttcaatgttgat
aacatcagagtatgtaagattctgggctctggtgtttattcatcctcagtattacatggc
atggtttttaagaaggaaacggaaggcgatgtgacatctgtcaaagatgcaaaaatagcc
gtgtactcttgtccctttgatggcatgataacagagacaaagggaactgtgctgattaag
actgctgaagaactgatgaactttagtaaaggagaagagaatcttatggatgcacaagtg
aaagccattgcaggcactggtgcaaatgtcatagtgacaggcggcaaagtggcagatatg
gctcttcattatgctaacaagtacaatatcatgctggtgagactgaactcaaagtgggat
ctcagacgactctgtaaaacagttggtgccacagctcttccaaaattgactcctcccgtc
ctagaagaaatgggacattgtgacagtgtttacctctcagaagttggagatacccaggtg
gttgtttttaagcatgaaaaagaagatggtgccatttctaccatagttcttcgaggttct
acagacaatctgatggatgatatagaaagggcagtagatgacggagttaatactttcaaa
gttctcacaagggataagcgtcttgtacctggaggtggagctacagaaatcgaattggcc
aaacaaatcacatcatatggagaaacgtgtcctggtcttgaacagtatgctattaagaaa
ttcgctgaagcatttgaagctattccacgggcactggcagaaaattctggcgtcaaggcc
aatgaagttatctctaaactctattcagtacaccaagaaggaaacaaaaatgtggggttg
gatattgaggctgaagttcctgctgtaaaggatatgttagaagccagtattttagatact
tacttgggaaaatactgggctattaaactggccactaatgctgcagtcactgtacttaga
gtggatcagatcatcatggcaaaaccagctggtgggcccaagcctccaagtgggaagaaa
gactgggatgatgaccaaaatgactga

DBGET integrated database retrieval system