KEGG   Rattus norvegicus (rat): 288306
Entry
288306            CDS       T01003                                 

Gene name
Usp16
Definition
(RefSeq) ubiquitin specific peptidase 16
  KO
K11844  ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    288306 (Usp16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    288306 (Usp16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     288306 (Usp16)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   288306 (Usp16)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    288306 (Usp16)
SSDB
Motif
Pfam: UCH zf-UBP UCH_1 DUF4638 Codanin-1_C RbpA EOS1
Other DBs
NCBI-GeneID: 288306
NCBI-ProteinID: NP_001093971
RGD: 1307192
Ensembl: ENSRNOG00000001598
UniProt: Q2KJ09
Position
11q11
AA seq 825 aa
MGKKRTKGKSVPEKASSESTEPMCRHLRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEEAEDPSVWLCLKCGHQGCGRDSQEQHALKHYTTPRSEPHYLVLSLDNWSVWCYKCDE
EIKYCSSNRLGQVVDYVRKQAGRITSKPEKNNGHIELENKKLEKESKNEQEREKSESMAK
ENIPLDSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLA
LTEPLEVNLEPPGPLTLAMSQFLNEMQENKKRIVTPKELFSQVCKKATRFKGYQQQDSQE
LLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEEVKNKVKDYEKKKAIPSFVDRIFGGE
LTSTIMCDDCRTVSLVHESFLDLSLPVLDDQSGKKNINDKNVKKTMEEEDKDSEEEKDDS
YMKTRSDVPSGTSKHTQKKAKKQAKKQAKNQRRQQKIQERFLHFNEICTTNYTEDNDHEA
ETALPGEGEVDTEFNRGSQEELTQTELCANQKDVNGQEEMIESAADERKCPEHPEVKSVS
TESDLGSLTSAPECPRDLNGAFLEERTSGELDITNGLKNLTLNAAVDPDEISIEILNDSH
SPALKVYEVMNEDPETAFCTLANREAFSTDECSIQHCLYQFTRNEKLQDANKLLCEVCTR
RQCNGPKANIKGERKHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEI
LDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGTMRSGHYTAYAKERTASCHLSNLVLHG
DIPQDCEMESTKGQWFHISDTHVQAVPITKVLNSQAYLLFYERIL
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgggaaagaaacgaacaaaggggaaaagtgttccagaaaaggcttcttctgaatctaca
gaaccaatgtgcagacaccttagaaaagggttggaacaaggtaatttgaaaaaagctttg
gtaaatgtggaatggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
tctgaggaagaagcagaagacccttcggtttggctgtgtcttaaatgtggccatcagggc
tgtggcagagattcccaggagcagcatgccctgaagcactacacaacaccaaggtctgaa
cctcactacctggtgcttagtttggacaactggagcgtctggtgttacaagtgtgatgag
gaaatcaagtactgcagttcaaaccggctgggccaagtggttgattatgttagaaagcaa
gctggcagaataacttcaaaaccagagaaaaataatggacacattgagcttgaaaataaa
aaattggagaaagagagtaaaaatgaacaagagagagaaaaatcggaaagcatggctaaa
gaaaacatccccttggactctgcttcccagataacggtgaaaggactcagcaacttgggg
aatacttgtttcttcaacgctgttatgcagaacttgtcacaaacgccagtgcttagagaa
ctactaaaagaagtgaagatgtctggaacaattgtaaaaatagagccacctgatctggca
ctcacagaacctttagaagtaaaccttgaacctccaggtcctcttactttagccatgagc
cagtttcttaatgagatgcaagagaacaaaaaacgaattgtaacacctaaagagctcttt
tctcaggtctgtaaaaaagcaacacgttttaaagggtaccaacaacaagacagccaggag
ctgcttcgctacctattggacgggatgagagcggaagagcaccaaagagtgagtaaagga
attcttaaagcatttggtaattctactgaaaaattggatgaagaagtaaaaaataaagtt
aaagattatgaaaagaaaaaggcaatcccaagttttgtggaccgcatcttcggtggcgaa
ctgactagtacaatcatgtgtgatgactgcaggactgtctccttggtgcatgagtctttc
cttgatttgtctctcccagttttagatgatcagagtggtaagaaaaatataaatgataaa
aatgtgaagaagacaatggaggaagaagataaagacagtgaggaagagaaagatgacagc
tacatgaaaacacggagtgacgtgccctcaggaacaagcaagcacacacagaagaaagca
aagaagcaagccaaaaagcaagccaagaaccaacgaaggcaacaaaaaattcaagaaagg
tttcttcacttcaacgagatctgcaccactaactacactgaagacaatgaccatgaagct
gagacggcacttccgggagaaggggaagtggatactgagttcaaccgtggctctcaagag
gagctcacacagacagagctctgtgctaatcagaaagatgtgaatggccaagaggaaatg
atagaaagcgctgccgatgagcggaaatgcccagagcacccggaggtgaaaagtgtcagc
accgagagtgatctggggagtttgacttctgctcctgagtgtcctagagatttaaatggt
gccttcctggaagaaaggaccagtggagagctagacattaccaatggtttaaaaaacctt
actttgaatgctgctgttgatcctgatgaaataagtatagagattctgaatgacagccat
tctcctgcgttaaaggtgtatgaggtcatgaatgaggacccagaaactgctttctgtacc
cttgcaaaccgggaagcttttagtactgatgagtgttcaatccaacattgtttgtatcag
ttcacccgcaatgagaaacttcaagatgcaaataaactgctttgtgaagtgtgcacaaga
cggcagtgtaatggaccaaaggcaaatataaaaggtgaaaggaaacatgtttacaccaat
gccaagaagcagatgctggtttcccttgctcctcctgtactcactcttcatttaaagaga
tttcagcaggctggttttaacctacgcaaagttaacaaacacataaagtttccggaaatc
ttagatttggctcctttttgtacccttaaatgtaagaacgttgctgaggaaagtacaaga
gtgctgtattccttatatggagttgtggaacacagtggcactatgaggtcagggcattac
actgcctacgcaaaggaaagaactgcaagctgtcatctctctaatcttgttcttcatggt
gacattccgcaagattgtgaaatggagtcaaccaaagggcagtggtttcacatcagcgac
acacacgtgcaagcggtgcctataactaaagtactgaactcacaagcttatctcctattt
tatgagagaatactgtga

DBGET integrated database retrieval system