KEGG   Rattus norvegicus (rat): 288360Help
Entry
288360            CDS       T01003                                 

Gene name
Car15
Definition
(RefSeq) carbonic anhydrase 15
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    288360 (Car15)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     288360 (Car15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 288360
NCBI-ProteinID: NP_001099371
RGD: 1306018
Ensembl: ENSRNOG00000057036
UniProt: D3ZBQ6
Position
11q23
AA seq 323 aa AA seqDB search
MWALGFRLCFLLMLAAQVDSNGTWCYDSQDPKCGPAHWKELAPACGGPTQSPVNIDLRLV
QRDYALKPFIFHGYDSAPQDPWILENDGHTVLLRVHSCQQNCPAIRGAGLPSSEYRLLQL
HFHWGSPGHKGSEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKD
NTNFSAIVSGLKNVSSPGVSVNLTSTFALASLLPSALGLLRYYRYSGSLTTPGCEPAVLW
TVFENTVPIGHAQVVQFQAVPQTGPPGLHPRPLTDNFRPQQPLGGRRISASPGASIRSSV
PIRPCLHLALLGLGVGLRLWQGP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccctgggcttccggctctgcttcctcctcatgctggcggcacaggtggactcc
aatggtacctggtgctatgactcccaagacccaaagtgtggccctgcccactggaaggag
ctagcacctgcctgtgggggcccaacccagtcccctgtcaacattgaccttcgattggtc
cagcgggactacgctcttaagcccttcatctttcacggctatgactcagcacctcaagat
ccttggatcctggaaaatgatggccatacagtgctactgcgagtacattcctgtcagcag
aactgcccagccatccgaggtgctgggctcccatcatcagaataccggttactgcagctg
catttccactggggaagcccagggcacaaaggctcggagcacagtgtggatgagaagcat
ggctctatggagatgcacatggtccacatgaacacaaagtaccagagcatggggcatgcg
cggagccaaccagatgggctggctatactggctgtgctattggtggaggaggacaaggac
aataccaatttctctgccatcgtgtctggtctgaaaaatgtatcttcacctggggtctct
gtgaatctgacgtccacctttgcgctggcctctctgctgccaagtgctttgggacttttg
cgctactaccgatactctgggtctctgaccacgccaggctgcgagcccgcggtgctctgg
actgtctttgaaaacaccgtacccattgggcatgcgcaggtagtccagttccaggccgtg
ccccagactgggccaccaggtttgcaccccagaccactcacagataatttccgcccccag
cagcctcttggagggcgaagaatatcagcctctcctggagcatccatccgatcatcagtc
cctatccggccctgtttgcacttggctcttttgggcttgggagttggcctgaggctctgg
cagggtccctag

DBGET integrated database retrieval system