KEGG   Rattus norvegicus (rat): 288371
Entry
288371            CDS       T01003                                 

Gene name
Mcoln1
Definition
(RefSeq) mucolipin-1
  KO
K04992  mucolipin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    288371 (Mcoln1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    288371 (Mcoln1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    288371 (Mcoln1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   288371 (Mcoln1)
SSDB
Motif
Pfam: PKD_channel Ion_trans
Other DBs
NCBI-GeneID: 288371
NCBI-ProteinID: NP_001099373
RGD: 1308953
Ensembl: ENSRNOG00000000975
UniProt: D3ZRF9
Position
12
AA seq 580 aa
MATAAGRRGSETEQLLTPNPGYGTQAGTSPAPTTPPEEEDLRRRLKYFFMSPCDKFRAKG
RKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAY
TREQLYQAIFYAVDQYLTLPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPAND
TFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSTSYKNITLKFHKLINVTIHFQLKTI
NLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETQTHIQECKHPSVSRHGDNSFRLL
FDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVT
SDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRV
ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAY
IEQCQDSPTSGKFRRGSGSTCSLLCCCGRNSPEDHSLLVN
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggccaccgcggcgggccggcgcggctcagagaccgagcaattgctgacccccaatcct
gggtatgggacccaggcggggacctcaccagcccccacaacccccccagaagaggaagac
ctccgccgccgcctcaagtacttttttatgagtccatgtgacaagttccgggccaaaggt
cgcaagccctgcaagttgatgctgcaggtggtcaagatcttggtggtcactgtgcagctc
attctctttggactcagcaaccagctggtggtgacattccgggaagagaacaccattgcc
ttccgacacctcttcctgctgggttactctgatgggtctgatgacacctttgcggcctac
acacgggagcagctctaccaagccatcttctatgctgtggaccagtacctgacactaccc
gagatatccctgggccggtatgcctatgtccgtggtgggggcgggccttgggccaatggc
tcagctctggctctctgccagcgatattaccaccgtggccatgtggacccagccaacgat
acctttgacattgatccaagggtagtcactgactgtatccaggtggatcctcctgacaga
cctcctgacatccccagtgaggacttggacttcttggatggcagcaccagttacaagaac
atcacattgaaattccacaagctgatcaacgtcaccatccacttccaactgaagacaatt
aacctgcagagcctcatcaacaacgagatccctgactgttacaccttcagtatcctgatc
acatttgacaataaagcacacagtgggcgaatccccatccgcctggagacccagacccac
atccaggagtgtaaacaccccagtgtctccagacacggagacaacagcttccggcttctg
tttgatgtggtggtcatcctcacctgctccctgtccttcctgctgtgtgcccgctcactg
ctccgtggcttcctgctgcagaacgagtttgttgtattcatgtggcggcggcggggccgg
gaaatcagcctctgggaacggctggagtttgtcaatggctggtacatcctgctggtcacc
agtgacgtgcttaccatctcggggactatcatgaagattggcattgaggcaaagaaccta
gccagctatgatgtctgcagcatcctcctgggtacctccactctgctggtctgggttggt
gtcattcgctacctgacatttttccacaagtacaatatcctgattgccacgttgcgagtg
gcactgcccagtgtcatgcgtttctgctgctgtgtggctgtcatctacctgggctattgc
ttctgcggctggattgtcctgggaccctaccatgtgaagttccgctcgctgtccatggtt
tccgagtgcctgttctccctcatcaacggggacgacatgttcgtgacgtttgcagccatg
caggcccagcagggtcgcagtagcctggtgtggctcttctcgcagctctacctctactcc
ttcatcagcctcttcatctacatggtgctgagtctcttcatcgcactcatcaccggcgcc
tacgacactatcaagcacccaggaggcactggcacagagaagagtgagctccaggcctac
attgagcagtgccaggatagccccacgtctggcaagttccgtcgtggaagtggctccact
tgtagccttctgtgctgctgtggaaggaactctccggaggaccattcactgctggtgaac
tga

DBGET integrated database retrieval system