KEGG   Rattus norvegicus (rat): 288414Help
Entry
288414            CDS       T01003                                 

Gene name
Rfc3
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno03420  Nucleotide excision repair
rno03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    288414 (Rfc3)
   03420 Nucleotide excision repair
    288414 (Rfc3)
   03430 Mismatch repair
    288414 (Rfc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    288414 (Rfc3)
   03036 Chromosome and associated proteins [BR:rno03036]
    288414 (Rfc3)
   03400 DNA repair and recombination proteins [BR:rno03400]
    288414 (Rfc3)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    288414 (Rfc3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     288414 (Rfc3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    288414 (Rfc3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     288414 (Rfc3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    288414 (Rfc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol3_delta2 Rad17 AAA AAA_16 AAA_22 DNA_pol3_delta ABC_tran Rep_fac_C ATPgrasp_ST DUF2247 Sigma54_activ_2 AAA_5 CHB_HEX
Motif
Other DBs
NCBI-GeneID: 288414
NCBI-ProteinID: NP_001009629
RGD: 1306832
Ensembl: ENSRNOG00000001088
UniProt: Q5M830
Position
12p12
AA seq 356 aa AA seqDB search
MSLWVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETSSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AIRVPAPSIEDICSVLSTVCKKEGLALPSKLARRLAEKSCRNLRKALLMCEACRVQQYPF
TEDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEVIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMVF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctgggtggacaaataccggccgagctcccttgcacggctggactatcacaag
gagcaggcagcacagctgcgcaacctggtgcagtgtggagactttcctcacctcttagta
tatggaccatcgggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtgttggggtggaaaaactgagaattgagcatcagactatcacaactccatctaagaaa
aaaattgagatcagcaccattgcaagtaactaccaccttgaggttaaccccagcgatgca
ggaaacagcgaccgggtcgtaatccaggagatgctgaagacagtggcccagtcacaacag
cttgaaaccagctcacaaagagacttcaaagtggtgttactgacagaggtggacaagctc
acgaaggacgcccagcacgccttgcgcaggaccatggagaagtacatgtctacctgcagg
ctgatcctgtgctgcaattccacgtccaaagtgataccccccatccgaagcaggtgcctg
gccatccgtgtgcctgcccccagcatcgaagatatttgcagtgtactgtccaccgtctgc
aagaaggaaggtctggcccttccttcaaagttggctcgcaggctggccgagaagtcgtgc
aggaacctcaggaaggccttacttatgtgcgaagcctgccgagtgcagcaataccctttc
accgaagaccaagaaatccctgagacagactgggaggtgtacctgagggagactgcaaat
gccattgtcagtcagcagacgccacagaggctcctcgaagtccgaggaaggctctatgag
cttctgacgcactgtattcctcctgaggtaatcatgaagggcctgctctcagaactcctg
cataactgtgacgggcagctgaaaggggaagtggcacagatggcggcctattatgagcat
cgcctgcagctgggcagcaaagcgatctatcatctggaagcatttgtggcgaagtttatg
gcactttataagaagttcatggaggacgggctggaaggcatggtgttctga

DBGET integrated database retrieval system