KEGG   Rattus norvegicus (rat): 288416Help
Entry
288416            CDS       T01003                                 

Gene name
N4bp2l2
Definition
(RefSeq) NEDD4 binding protein 2-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_33 Zeta_toxin AAA_18 AAA_16 KTI12 ABC_tran TsaE
Motif
Other DBs
NCBI-GeneID: 288416
NCBI-ProteinID: NP_001005533
RGD: 1359603
Ensembl: ENSRNOG00000001108
UniProt: Q66H65
Position
12p12
AA seq 574 aa AA seqDB search
MPYSEIEAKFLGPGKELTREPCYKKLKSAVDDGVFPHRGGPDSHRIQEKTKNNRLPVATI
NFRRRVCPGEDKTSTDVLKPLHKEMPGDKVGGTESIGSQALQDGKPLAPARDDEIYSTSK
AFIGPIYKPPEKKKCRERKNETATFNNTDSKRRQEEKQKFNSKKLEIDTELSQFYKEIEE
LENENEASQGSCKEPEPSQEQTLSHDQACNTLKPEGESKDLSTVLQSHCGYQPYLEDESD
YPCDEQLIPAFCDTSFPSFRPEWQSVHPFVIPHDPLPSFNYFNIQRFGAPLHPPPSVFHA
RDDARLQSGCYIDSYQDGWSCLTLDQNDEYANYDVPGNVHPFGNGYGVQDDSVKNGFCEI
RECWQDPSMDMHNEADRFVNQCFQEDRLNKLQKLLILLRGLPGSGKTTLSRILLGQSRDG
IVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNTQAWEMKPYV
EMAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEFQMSISIVMNSVE
PTQKSTQTPLPLQGDQRWGGSLGSHSQVSITDDY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgccttatagtgaaattgaagctaagtttttgggacctggaaaagaactaacaagggaa
ccatgttataaaaagttgaaatcagctgtagatgatggtgttttcccccatcgaggtgga
cctgatagtcacagaatccaagagaaaactaaaaataataggctccctgtggccaccatt
aacttcagaagacgtgtttgtcctggagaagacaaaaccagtacagatgtgttaaagcct
ttgcacaaggagatgcctggtgataaagtgggtggcactgaatccatcggttcacaagct
ttgcaggatggaaagcctttagcaccagccagggatgatgaaatctatagcacaagtaaa
gcattcataggccccatttacaaaccccctgaaaaaaagaaatgccgtgagaggaagaat
gagacagctactttcaataatacagatagcaaaagaagacaagaggaaaaacaaaaattt
aactccaaaaaattggagattgacacagagttatcgcagttttacaaagaaatcgaagaa
ctggaaaatgaaaatgaagcttcccaaggcagttgtaaggaaccagaaccttcccaggaa
cagactctttctcatgaccaggcctgcaataccttaaaacctgagggggaaagtaaagat
ctgagcactgttcttcagtcacactgcggctatcaaccatacctggaagatgaatcagac
tatccctgtgatgaacagttgatacctgcattttgtgatacttcatttccttccttcagg
cctgagtggcagtcagtacatccttttgtcataccccatgatcctctgcccagttttaat
tactttaatattcaaagatttggtgccccactacatccaccaccaagcgttttccatgcg
cgagatgacgctcggttgcagagtgggtgttacatagacagttatcaggacggctggagc
tgtttgactttggatcagaacgatgagtatgctaactatgatgtgcctggcaatgtccac
ccctttggaaatggctatggtgtacaagatgacagtgtgaagaatggtttctgtgaaatc
agagagtgctggcaagatccttccatggacatgcataatgaagcagacaggtttgtgaac
cagtgctttcaagaggacaggttaaataaattgcagaaattacttattcttctgcgaggc
ctccccggttctggaaaaacaacattgtctcgaattctgcttggtcagagtcgtgatggc
atcgtgttcagcactgatgactactttcatcatcaagatgggtacaggtacaatgttaat
cagcttggtgatgcccatgactggaaccagaacagagcaaaacaagctatcgatcagggg
agatctccagttatcatagacaacactaatacacaagcctgggaaatgaaaccctatgtg
gaaatggccataggaaaaggatacagagtagagtttcatgaaccggaaacttggtggaag
tttgaccctgaagaattagaaaagaggaataaacatggcgtgtctcgaaagaagattgct
cagatgttagaccgttatgaatttcaaatgtccatctccatcgtgatgaattcagtggaa
ccaacacagaaaagcacacaaacaccccttcctctccagggggaccagaggtggggaggc
tctctaggctcacatagtcaagtatctatcacagatgactattga

DBGET integrated database retrieval system