KEGG   Rattus norvegicus (rat): 288449Help
Entry
288449            CDS       T01003                                 

Gene name
Katnal1
Definition
(RefSeq) katanin p60 subunit A-like 1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    288449 (Katnal1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     288449 (Katnal1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     288449 (Katnal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Vps4_C AAA_16 RuvB_N AAA_33 AAA_2 AAA_5 TIP49 Mg_chelatase TsaE AAA_14 IstB_IS21 AAA_22 AAA_18 AAA_7 AAA_24 NACHT AAA_28 PhoH RNA_helicase Guanylate_kin AAA_30 AAA_25 AAA_17
Motif
Other DBs
NCBI-GeneID: 288449
NCBI-ProteinID: NP_001006957
RGD: 1359252
Ensembl: ENSRNOG00000047618
UniProt: Q5XIK7
Position
12p11
AA seq 488 aa AA seqDB search
MNLAEICENAKKGREYALLGNYDSSMVYYQGVIQQIQRHCQSLRDPATKAKWQQVRQELL
EEYEQVKSIVSTLESFKMDKPPDFPVSCRDEPFRDPAVWPPPVPAEHRAPPQIRRPNREV
RPLRKDMGAGARGLVGRAHQISKSDKAASRDKDYRARGRDDKARKNMQDGASDGEIPKFD
GAGYDKDLVEALERDIVSRNPSIHWDDIADLEEAKKLLREAVVLPMWMPDFFKGIRRPWK
GVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPT
TIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSKMVMVLAATNFPW
DIDEALRRRLEKRIYIPLPTAKGRAELLKISLREVELDPDIHLEDIAEKTEGYSGADITN
ICRDASLMAMRRRINGLSPEEIRALSKEELQMPVTRGDLELALKKIAKSVSAADLEKYEK
WMVEFGSA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggccgagatttgtgagaatgcgaagaaaggccgggaatatgcacttctgggg
aattatgactcgtcaatggtgtattaccagggagtaatacagcagatccagagacactgc
cagtcactgagagacccggccaccaaagcgaagtggcagcaggttcggcaggagctcttg
gaagaatatgaacaagttaagagtatcgtcagcacgttagaaagctttaagatggacaag
ccccctgacttccctgtgtcttgtcgagacgaaccgtttagagatccggcagtatggcca
cccccggtccctgcagaacacagagcaccacctcaaatcaggcgtcccaaccgagaagtg
aggcctctgcggaaagacatgggggcaggagcccggggcctcgtgggccgagcacaccag
atatcgaagagtgataaagctgcaagtcgggacaaggactatagagcaagagggagagat
gacaaggcaaggaaaaatatgcaagatggcgcaagtgatggtgagatccccaagttcgat
ggcgctgggtatgacaaggatctggtggaggctctggagagggacattgtgtccaggaac
cctagcattcactgggatgatatagcagatctggaggaagctaagaagttgctccgggaa
gctgttgtccttcccatgtggatgcctgactttttcaaagggattagaaggccatggaag
ggtgtgctgatggtcggccctccagggactggtaagactatgctggctaaagctgttgcc
accgaatgtgggacaacctttttcaacgtctcctcttccaccctgacgtctaagtaccga
ggcgagtctgagaagttggtccgtctgttgtttgaaatggcgaggttctatgcccctacc
acgatcttcatcgacgaaatagactccatctgcagtcgaagagggacctccgatgagcat
gaggccagccgcagagtgaagtccgagctcctcatccagatggacggagttggaggagcc
ttagaaaacgatgatccatccaaaatggtgatggtcctggcggctacgaacttcccgtgg
gacatcgatgaggctctgcgcaggagactggagaagaggatctacatccctctccccaca
gcaaaaggaagggcggagctcctgaagatcagcctccgggaggtggagctggaccccgac
atccacctggaggacatcgctgagaagacggagggctactcgggcgctgacataactaac
atctgcagagatgcttctctgatggccatgaggcggcgcatcaacggcctgagtccagaa
gagatcagggccctgtccaaggaggagctgcagatgcctgtcaccagaggggacttggag
ctggcgctgaagaaaatcgccaagtctgtctctgcggcagacctggagaagtacgaaaag
tggatggttgagttcggatctgcgtga

DBGET integrated database retrieval system