KEGG   Rattus norvegicus (rat): 288478
Entry
288478            CDS       T01003                                 

Gene name
Rsph10b, RGD1311893
Definition
(RefSeq) radial spoke head 10 homolog B
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MORN SM-ATX
Other DBs
NCBI-GeneID: 288478
NCBI-ProteinID: NP_001013889
RGD: 1311893
Ensembl: ENSRNOG00000001036
Vega: OTTRNOG00000001896
UniProt: Q66HB5
Position
12p11
AA seq 876 aa
MVKEKKKADKKGDKSARSPSSISDNPEAAKQEISASKQEVAPSAVIPVLETPLKQTPKRD
SEHTYQSEDETQYEEPILTKLIVESYEGEKVRGLYEGEGFAVFQGGNTYHGMFSEGLMHG
QGTYIWADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGEVVNGMRNGFGMFKCGTQPVSYI
GHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEG
RMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGAFVNGFRHGQGKFY
YASGAMYEGEWVSNKKQGRGRITFKNGRVYEGLFSNDHIAQFFEAEMDYSYSLDRRSDIS
QRSRQARGSSVSADREPETLRKLDGSESRSVLGSSIELDLNLLLDMYPEESQEEEKKQVE
YAVLRNITELRRIYCFYSGLGCDHSLDNTFLMTKLHFWRFLKDCRFHHHNITLADMDRVL
SVYNGIPIEEIHSPFRTILLRTFLNYLLQLAYYIHHKEFQNRSPSLFLCFTKLMAENIHP
HACQVKGHLFNEQQRTLYSMNYIDKCWEIYTAYCRPNEAPPYELTMKMRYFLWMLKDFRM
INKELTATKFMRVIAEDNPFVYDGMDSNFELELVFLEFFEALLCFSLCCMFDQMTRSYLK
APYDDVTTNRYGSTQTVLNQSIHRSPSGATSHDSEVHFSSTKSSLDKIGVLPDGKIRQSE
PKLKKSLSEDKVSKMNLKAQGRGLVFMSPHGEKYEKSKDEQKEKLNMWVNNLYVFFVSVL
FSAYKHEEALKEKVEENRLQEAVLAQQKQIENEELEARLNILREEEARRQDFELDITVLK
EPPEVPAVQPLTPSPPKEDLVSMQTSKASPGKKKKK
NT seq 2631 nt   +upstreamnt  +downstreamnt
atggtgaaagaaaagaaaaaagcagacaaaaagggagataagtcagcccgctctccctcc
tcgatctctgataacccagaagcggctaaacaagaaatcagtgccagtaagcaggaagtg
gcccccagtgctgtcatcccggtattggaaacgccactcaagcaaacccctaaaagagac
tcggaacatacataccagagtgaagatgaaactcagtatgaagaacccatcctgaccaaa
ctcatagtggaaagctacgaaggggagaaagtccgtggactgtatgagggagaaggcttt
gcggtctttcaaggcggaaacacctaccatggaatgttttccgagggactgatgcacggg
caggggacttacatttgggctgacggattgaaatacgagggggactttgtgaagaacatc
cccatgaatcatggcgtgtacacatggccagatggcagcacgtatgaaggagaagtggtc
aacggcatgaggaacggattcggtatgttcaagtgtggcacgcagcccgtgtcctatatt
ggccactggtgtcacggcaagagacatgggaagggctccatctattacaatcaagaggga
acctcttggtatgaaggagactgggtgtacaacatcaaaaagggctggggaatacgatgc
tacaaatcaggaaacatatacgaaggccagtgggagaacaacatgcgccacggggaaggc
aggatgaggtggctcacaacaaacgaggagtacacgggccactgggagaaggggatccag
aacggctttggaacgcacacatggttcctaaagagaatccccaactctcagtatcctttg
agaaatgaatacataggggcgtttgtaaatggcttccgtcatggacaagggaagttttat
tatgccagtggagccatgtatgagggagaatgggtttccaacaaaaagcagggcaggggc
aggataactttcaagaatggccgtgtgtatgaaggtctgttttccaacgatcacattgca
cagttctttgaagctgaaatggattactcgtacagcctggaccgtcggtcagacatctcc
caaaggagccggcaggctcggggatcttctgtcagtgctgacagggagcctgaaacccta
cgaaagttggatggcagcgaaagccgctctgtgttaggatcgagtattgagctggactta
aatttgttgctggacatgtaccctgaggaaagccaagaagaagaaaagaagcaggtggaa
tatgccgtcctaaggaacatcacagagttaagaaggatctactgcttctacagcggcctt
gggtgtgaccactctctggataacaccttcctgatgacaaagcttcacttctggagattt
ctgaaagactgcaggttccatcaccacaacataactcttgcggatatggacagggtattg
agtgtctataacggcatcccaatcgaagaaatccattctccatttagaaccatactctta
agaacattcctaaattacctcctgcagctggcctactacatccatcacaaagaattccag
aacagaagcccgtccctctttctgtgcttcacaaagctgatggccgagaacatccatcca
cacgcctgccaggtgaaaggtcacttattcaatgagcagcagcggacactctactcaatg
aattacatcgataagtgctgggaaatttacacagcctactgcagaccgaacgaagcccca
ccctatgagctgacaatgaagatgagatatttcctctggatgctgaaagactttaggatg
ataaataaggagttaactgcgaccaaattcatgagggtgatagcggaggacaaccctttc
gtatatgatggaatggacagcaactttgaacttgagctagttttcctggagttcttcgaa
gctctgttgtgcttctctctctgctgcatgtttgaccagatgactagatcctatttaaaa
gccccgtacgatgacgtcactacaaaccgatatggcagcactcagacggtactaaaccag
agcatccacaggagcccaagtggggccacaagccatgactccgaagtccacttcagcagc
accaagtcgtccttagacaagataggagtcctgcccgatggtaaaatcaggcaatcagag
cccaagctcaagaagtcgctgagtgaggacaaagtctccaaaatgaacctcaaggctcaa
ggaagagggctggtgtttatgtctccacatggtgagaaatatgaaaagtccaaagatgaa
cagaaagagaaactcaacatgtgggtgaacaacctctacgtcttcttcgtcagtgtgctc
ttcagcgcctacaaacacgaggaggcgctcaaggagaaggtggaggagaacaggctccag
gaagcagtgctggctcagcagaagcagatcgagaacgaggagctggaggccaggctgaac
atcctacgggaagaagaggccaggagacaagactttgaacttgacatcactgtgctcaag
gagccaccggaggtcccagccgtacagccgctcacacccagcccccctaaagaggacttg
gtttccatgcagactagcaaggccagcccaggcaagaagaagaagaagtga

DBGET integrated database retrieval system