KEGG   Rattus norvegicus (rat): 288498
Entry
288498            CDS       T01003                                 

Gene name
Wipi2
Definition
(RefSeq) WD repeat domain phosphoinositide-interacting protein 2
  KO
K17908  autophagy-related protein 18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    288498 (Wipi2)
   04136 Autophagy - other
    288498 (Wipi2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    288498 (Wipi2)
   05014 Amyotrophic lateral sclerosis
    288498 (Wipi2)
   05016 Huntington disease
    288498 (Wipi2)
   05017 Spinocerebellar ataxia
    288498 (Wipi2)
   05022 Pathways of neurodegeneration - multiple diseases
    288498 (Wipi2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288498 (Wipi2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    288498 (Wipi2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    288498 (Wipi2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    288498 (Wipi2)
SSDB
Motif
Pfam: ANAPC4_WD40 VID27
Other DBs
NCBI-GeneID: 288498
NCBI-ProteinID: NP_001007616
RGD: 1359154
Ensembl: ENSRNOG00000001114
UniProt: Q6AY57
Position
12
AA seq 445 aa
MNLASQSGEAGAGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCI
VERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLY
IHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMI
PAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSM
DGMFLSASSNTETVHIFKLEAVREKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGR
AFATVRLPFCGHKNICSLTTIQKIPRLLVGASDGYLYMYNLDPQEGGECALMRQHRLDGS
METTSEIVDSASHDCPLVTQTYGTAAAKGAYVPSSPTRLGKGQDANLEAYTDDLGAVGGA
CLEDEASALRLDEDSEHPPMILRTD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaacctggcaagccagagcggagaggccggcgccggccagctgctgttcgccaacttc
aaccaggataacacgtccctagctgttggtagtaagtccgggtataagtttttctcccta
tcttctgtggataagctggaacagatctatgaatgcactgacaccgaagatgtctgcatc
gtggagagattgttctcaagcagcttggtggccatcgtcagcctcaaagctcccaggaag
ctgaaggtttgccactttaagaaggggactgagatttgcaactacagctactccaacacc
atcctggctgtgaagctgaacaggcagaggctcatcgtgtgtctagaagagtcgctctat
atacacaacatccgggacatgaaggtacttcataccatccgagagacacccccgaaccct
gcaggcttgtgtgcactgtcaataaacaatgacaactgctacttggcgtacccagggagt
gcgaccattggagaggtgcaggtcttcgacaccattaacttgagggctgcaaacatgatc
ccagctcatgacagtcccttagcagccctggcttttgacgcaagtgggaccaagcttgcc
actgcttctgagaaggggactgtgattcgagtgttctccattccagagggacagaagctg
tttgagttcaggagaggagtgaaaaggtgtgtgagcatctgctccctggccttcagcatg
gacggcatgtttctctccgcatccagcaacaccgaaacagtgcacatcttcaaacttgaa
gccgtgagggaaaaacctccggaagagcccaccacctggactggctactttgggaaggtt
ctcatggcatctaccagctacctgccctcacaagtgacagaaatgttcaatcagggaagg
gcctttgccaccgtccgcctgccattttgtggccacaaaaacatctgctcactcaccaca
attcagaagatcccgcgattgctggtgggagcgtcggatggttatttgtacatgtacaac
ctggacccccaggaaggcggcgagtgcgccctgatgcgtcagcacaggcttgatggcagc
atggagacgaccagtgaaattgtagactctgcatctcatgactgccccttagtaacgcag
acatacggcacagcagctgccaaaggtgcctatgtgccctcgtccccaacaagacttggt
aaaggacaggacgccaacttggaagcctacaccgatgacctgggtgctgtgggtggcgca
tgcctagaggatgaagccagcgctctacgcctggatgaagatagtgaacatcctcccatg
attctccggactgactga

KEGG   Rattus norvegicus (rat): 303630
Entry
303630            CDS       T01003                                 

Gene name
Wipi1
Definition
(RefSeq) WD repeat domain phosphoinositide-interacting protein 1
  KO
K17908  autophagy-related protein 18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    303630 (Wipi1)
   04136 Autophagy - other
    303630 (Wipi1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303630 (Wipi1)
   05014 Amyotrophic lateral sclerosis
    303630 (Wipi1)
   05016 Huntington disease
    303630 (Wipi1)
   05017 Spinocerebellar ataxia
    303630 (Wipi1)
   05022 Pathways of neurodegeneration - multiple diseases
    303630 (Wipi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303630 (Wipi1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    303630 (Wipi1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    303630 (Wipi1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    303630 (Wipi1)
SSDB
Motif
Pfam: ANAPC4_WD40 DUF5711 BCAS3 Big_2
Other DBs
NCBI-GeneID: 303630
NCBI-ProteinID: NP_001120769
RGD: 1307754
Ensembl: ENSRNOG00000003827
UniProt: B2RYM2
Position
10
AA seq 446 aa
MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKTGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYCYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPSNPTGLCALSINHSNSYLAYPGSQSTGEIVLYDGNSLKMVC
TIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQLTDSRPEEPSTWSGYMGKMLTAATNYLPAQVSDMMNQ
DRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYIYNLDPQDGGECVLIKTHSLL
SSGTAEENKENDLRPSLPPSYAATVARPSASTASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGSQKGKTKQS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggccgaagctgcagatgcccctccgggccgagtggaggcggcgctcagctgcttc
tctttcaaccaagactgcacatccctagcgattggaaccaagactggttacaagctgttt
tctctgagttctgtggagcaacttgaccaagtccatggaagcaatgaaatccccgacgtg
tatattgtggagcgcctcttctccagcagcctggttgtggtggtcagtcacacaaaacct
cggcagatgaacgtctaccacttcaagaaaggcaccgagatctgtaattactgctactcc
agtaacattttgtctattcggctgaaccgacagagactgctggtctgcctggaagaatcc
atctatatccacaatattaaggacatgaagctattgaagaccctcctggatatcccttca
aacccgacaggtctctgtgccctttcaatcaaccattccaactcttacctggcctacccc
ggaagccagagtacaggcgagattgtactctatgacggaaactccctgaaaatggtgtgc
accattgctgcccacgagggaaccctggccgccatcaccttcaactcctccggctccaaa
ctagcaagtgcgtctgaaaaaggcaccgtcatccgagtgttctctgtgcccgaagggcag
aaactctatgagttccgtcgaggaatgaaaaggtatgtgacaatcagctctctggtgttc
agtatggactcccagttcctgtgtgcctccagcaacacggagaccgtgcacatcttcaag
ttggaacagctgaccgacagccgcccagaagagccttccacctggagcggctacatggga
aagatgctcacggcggctaccaactacctccccgcccaggtgtcggacatgatgaaccag
gacagggccttcgccacaggacgcctgaacttctctgggcagaagaacatttgcaccctg
tccacgatccagaaactgccgcggctgctagtagcctcctccgatggacacctctacatc
tacaatttggaccctcaggatggaggagaatgcgtcttaatcaaaacccacagcttgctg
agctcaggaacagcagaagagaacaaagaaaacgacctcagaccttccttacctccgtcg
tatgctgcaactgtagccagacccagcgcatccacagcctccaccgtgccagggtactct
gaggacggtggggcgctccgtggagaagtgattccagaacacgagtttgcaacgggccca
gtgtgtcttgacgatgagaatgagttcccccctataatcttgtgccgtggaagtcagaag
ggcaaaacgaagcagtcctga

DBGET integrated database retrieval system