KEGG   Rattus norvegicus (rat): 288527Help
Entry
288527            CDS       T01003                                 

Gene name
Asmtl
Definition
(RefSeq) acetylserotonin O-methyltransferase-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Maf
Motif
Other DBs
NCBI-GeneID: 288527
NCBI-ProteinID: NP_001099385
RGD: 1306877
Ensembl: ENSRNOG00000028166
UniProt: D4AA35
Position
12q11
AA seq 226 aa AA seqDB search
MALKPLAPLLRGYHVVLASASPRRREILDLAGVVFDVIPSHFSEVPPPEHLLRPQDLVIA
NAKGKALDVGMRLSQADPETQHLIIGADTIVAMEGQIMGKPCDREDALRMLTRLNGREHS
VITGVAIILTGGAGTRDAEVVVVFHEETLVTFSKLSDELVQEHVEGGEPWDKAGGYGLQA
RGGAIMAEAVRGDPLNAAGLPLNRLCRELGRRLLPSGPGQEVESQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaagccgctcgccccgctcctgcgcggttaccacgtggtcctggcgagcgct
tcgccaaggcggagggagatcctcgacctggcgggcgtggttttcgacgtcatcccctcg
cacttctcggaggtcccgcccccggagcacctgctccgccctcaggacttggtgattgca
aatgccaaagggaaagccttggacgtcggaatgcgcctaagccaggctgacccggagacc
cagcacctcatcattggagcggacaccattgtggccatggaggggcagatcatggggaag
ccctgcgaccgtgaagatgcactccggatgttaaccaggctgaacggtcgtgagcacagt
gtcatcaccggtgtcgccatcatccttacgggtggagcaggcacccgtgacgcagaggtg
gtggtggtcttccacgaggagacgctggtgacattctcgaagctgtcagatgagcttgtg
caggagcatgtggagggcggggagccctgggacaaggcggggggctacgggctgcaggcg
cggggcggagcgataatggcagaggccgtgcggggtgaccccctcaatgcagcggggctc
cctctcaaccggctctgccgcgagctggggcgccggctgctgccttcgggaccaggacag
gaagtggagtcgcagacatga

DBGET integrated database retrieval system