KEGG   Rattus norvegicus (rat): 288545Help
Entry
288545            CDS       T01003                                 

Gene name
RGD1305455
Definition
(RefSeq) similar to hypothetical protein FLJ10925
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4707
Motif
Other DBs
NCBI-GeneID: 288545
NCBI-ProteinID: NP_001020140
RGD: 1305455
Ensembl: ENSRNOG00000039214
UniProt: Q5BK00 A0A0G2KAX2
Position
12q11
AA seq 580 aa AA seqDB search
MESQCDYSMYFPAVPLPPRAELAGDPGRYRALPRRNHLYLGETVRFLLVLRCRGSAGPGV
GGGTGLASRGAWTELATALAALASVSAGGVLPGCGSAGDQDADPPGGGDPGGGGLFRSCS
PLLTHGPGPATSGGATTLPMEEPIVSTDEVIFPLTVSLDRLPPGTPKAKIVVTVWKREVE
APEVRDQGYLRLLQTRSPGETFRGEQSAFKAQVSTLLTLLPPPVLKCRQFTVAGKHLTVL
KVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTS
GYFPCPLSALEEHNFLFQLRGGEQPPPGAKEGLEVPLIAVVQWSTPKLPFTQSIYTHYRL
PSVRLDRPCFVMTASCESPVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEE
ERRAMQAALDSIVCHTPLNNLGFSRKGSALTFSVAFQALRTGLFELSQHMKLKLQFTASV
SHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAI
TPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVEPVK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccaatgcgactactcgatgtacttcccggctgtgccgctgccaccacgcgcc
gagctggccggggacccgggccggtaccgggcactgccccggcgcaaccatctgtacctg
ggggagacagtccgcttcctgctggtgctgcgctgccggggcagcgcggggcctggcgtt
gggggcggcacaggcttggcatcccgaggggcctggactgagctggcgactgccctggcc
gccctggcttcggtcagcgccggaggagtgctgcctgggtgcggcagcgccggcgaccag
gatgctgaccccccggggggaggggaccccgggggcgggggtttgtttcgaagctgcagc
ccccttctcacccacggcccgggccctgctacctcagggggagcgaccacgctgcctatg
gaagaaccgattgtgtccacagatgaggtcatcttcccactcaccgtttcactggataga
ctgcccccagggacacccaaggccaagattgtagtgaccgtgtggaagcgggaggtcgag
gcaccagaagtcagagatcaaggctacctgcgcttgctacagactcgatctcctggggag
actttccgtggagaacagagcgccttcaaggcccaagtgagcaccctactgacgctgctg
ccccctccagttctgaaatgccggcagttcactgtggctggaaaacacttgaccgtcctc
aaggtgctgaatagctcttcccaggaagagatctccatctgggatatccgaatcctcccc
aacttcaacgccagttatctacctgtcatgcccgatggctctgtgctcctggtggacaat
gtctgccaccagtctggggaagtctccatgggctccttctgtcggcttcctggtacctct
ggctacttcccctgtccactcagtgccctggaggaacacaacttcctgtttcagctgaga
gggggcgaacagccccctcctggggccaaggagggccttgaagtccccttgattgctgtg
gttcagtggtctacccctaagctgcccttcacccaaagcatctacacccactaccgcctg
cccagtgtccgcctagaccgcccctgctttgtgatgaccgcttcttgtgagtcccctgtt
cggacctacgagcgtttcactgtcacctacaccctgctcaacaacctccaagacttcctt
gctgtgaggcttgtgtggaccccggaacacgcacaggctggaaagcagctttgcgaggag
gaacgtcgggccatgcaggcagccctagactccatcgtctgccacacacccctcaataac
cttggcttctcccgcaagggcagcgcgcttaccttcagtgtggccttccaggccctgagg
acggggctcttcgagctgagccagcacatgaaactgaagctccagttcactgccagtgtg
tcccaccctccacctgaggcccggcccctgtccagaaaaagcagccccagcagtcctgct
gtccgggacctggtggagaggcaccaggccagcctgggccgttctcagtctttctcccac
caacagccttcccgtagccacctcatgaggtcaggcagtgtgatggaacgcagggccatc
accccccctgtggcctcccctgtcggtcgtcccctctacctgcccccggacaaggctgtg
ctttctctagacaagattgccaagcgtgagtgtaaagtcctggtcgtggagcctgtcaag
tag

DBGET integrated database retrieval system