KEGG   Rattus norvegicus (rat): 288563Help
Entry
288563            CDS       T01003                                 

Gene name
Actl6b, Actl6
Definition
(RefSeq) actin-like 6B
  KO
K11652  actin-like protein 6B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    288563 (Actl6b)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    288563 (Actl6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    288563 (Actl6b)
   03036 Chromosome and associated proteins [BR:rno03036]
    288563 (Actl6b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     288563 (Actl6b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    288563 (Actl6b)
   PBAF complex
    288563 (Actl6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 288563
NCBI-ProteinID: NP_001099387
RGD: 1307763
Ensembl: ENSRNOG00000001408
UniProt: P86173
Position
12q12
AA seq 426 aa AA seqDB search
MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGEKEK
KGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMS
EAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVH
DGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKL
PQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLR
IPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDR
LNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQC
VERKCP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggggcgtctacggcggagatgaggtgggggcgctcgtctttgacattggctcc
ttctcagtccgagctgggtacgctggggaggactgccccaaggctgacttccccaccact
gtggggctgctggccgcagaagaggggggcgggctggagctggagggggagaaagagaag
aaagggaagattttccacatcgacaccaatgccctgcacgtgcctcgggatggagcagag
gtcatgtcgcccctcaagaacggcatgattgaggactgggagtgcttccgagccatcctg
gatcatacctacagcaaacatgtcaagtccgaaccaaacctgcacccagtactcatgtcg
gaggctccgtggaacactcgggccaagcgggagaagctgacagagctgatgttcgagcag
tacaacattcctgccttcttcttatgcaagacggccgtgctcacagcctttgcaaatgga
cgctccacaggcctggtgctagacagcggggccacccacactacagccatcccagtccat
gatggctatgtcctacagcaaggcatcgtcaagtcacccctggctggcgacttcatatcc
atgcagtgccgggagctcttccaggaaatggctattgatatcatccctccttacatgatt
gctgccaaggagcctgtacgggagggagcccccccaaactggaagaagaaggagaagcta
ccccaagtctccaagtcctggcataactacatgtgtaacgaggtgatccaagacttccag
gcctctgtactgcaggtgtctgattccccttacgatgaacaggtagctgcacaaatgccc
acagtgcattatgaaatgcccaatggctacaacacagactatggtgctgagagacttcgc
atccctgagggcctgtttgatccctctaatgtcaagggtctgtctgggaacaccatgcta
ggagtgggtcacgtggtcaccaccagcatcggcatgtgtgacatcgacattcgcccgggt
ctctatggcagtgtcattgtcactggcggcaacactctgcttcaggggttcacagacaga
cttaatcgggagctttcccagaagaccccaccgagcatgcggctcaagcttatcgccagc
aacagcaccatggaacgcaagttcagcccctggattgggggctccatcttggcctcactg
ggcacgttccagcagatgtggatctccaagcaggaatatgaggagggagggaagcagtgt
gtggagcggaagtgcccctga

DBGET integrated database retrieval system