KEGG   Rattus norvegicus (rat): 288587
Entry
288587            CDS       T01003                                 

Gene name
Alkbh4, RGD1308608
Definition
(RefSeq) alkB homolog 4, lysine demethylase
  KO
K10766  DNA N6-methyl adenine demethylase [EC:1.14.11.51]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    288587 (Alkbh4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.51  DNA N6-methyladenine demethylase
     288587 (Alkbh4)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 288587
NCBI-ProteinID: NP_001099390
RGD: 1308608
Ensembl: ENSRNOG00000001428
UniProt: B2GV83
Position
12q12
AA seq 301 aa
MAAVAAEVSHLQECGCKGIRTCLICERRLQRDPPWQISLQKKCCFLYCPDTGWAMGAEGS
DFEGWAFPFPGVTLTQDFVTPEEEAEMVRLMDCDPWKPSQSGRRKQDYGPKVNFRKQKLK
MAGFQGLPGFSQKVVQRMGLYPGLEDFQPVEQCNLDYSPERGSAIDPHLDDSWLWGERLV
SLNLLSATVVSMSREAPGSLLLCPVPSVGPDAFEGNSVAPSRSVPCQEVEVAISVPRRSL
LVLTGAARHQWTHAIHRRHIKARRVCATFRELASEFLPGGKQQELGQELLRTALSFQGRP
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcggctgtagcggctgaagtttctcatttgcaggagtgcggctgtaaaggtatccgg
acctgtctcatctgcgagagacgactccagagggacccgccctggcagatctcccttcag
aaaaaatgctgtttcctctactgcccggacacaggctgggccatgggggccgagggctct
gactttgagggttgggcgttccccttcccgggagtgacactcacacaggactttgtgacc
ccggaggaagaagccgagatggtgcgtctcatggactgcgacccttggaagccttcgcag
tccgggaggaggaagcaggactatggccccaaagtcaattttcggaagcagaagctgaag
atggcgggcttccagggtctccctggctttagccagaaggtagtccagagaatgggcctt
tacccggggctggaggacttccagcctgtggaacagtgtaacctggactacagccctgag
cggggctctgccatcgacccccacctggatgactcctggctgtggggcgagcgcctggtg
agcctcaacctcctgtcggccacagtggtgtctatgtcccgagaggcccccggcagcctg
ctgctctgcccagtcccctctgttggaccggatgcttttgagggcaacagcgtggcccct
agcaggtccgtcccctgccaagaggtggaggtggccatctcagtaccccgccgctccctg
ctggtgcttacaggggccgcccggcaccagtggacacacgccatccaccgcagacacatc
aaggcccgccgtgtgtgcgccaccttcagggagctggccagtgagttcctgcctggaggg
aagcagcaagaactgggccaagaactgctgcggactgcactgtccttccaagggagaccc
gtgtga

DBGET integrated database retrieval system