KEGG   Rattus norvegicus (rat): 288588
Entry
288588            CDS       T01003                                 

Gene name
Polr2j
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB11-a
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    288588 (Polr2j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    288588 (Polr2j)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    288588 (Polr2j)
   03400 DNA repair and recombination proteins [BR:rno03400]
    288588 (Polr2j)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     288588 (Polr2j)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      288588 (Polr2j)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L SHNi-TPR
Other DBs
NCBI-GeneID: 288588
NCBI-ProteinID: NP_001099391
RGD: 1310198
Ensembl: ENSRNOG00000001430
UniProt: D3ZQI0
Position
12
AA seq 117 aa
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaacgcccctccggccttcgagtcgttcttgctcttcgagggcgagaagaaaatcacc
attaacaaggacaccaaggtgcccaacgcttgcttgttcaccatcaacaaagaagaccac
actctggggaacatcattaaatcgcagctgttgaaggacccgcaggtgctgtttgccggc
tacaaagtccctcaccccttggagcacaagatcatcattcgtgtgcagaccaccccagac
tacagcccccaggaggctttcaccaatgccatcacagacctcatcagtgagctctccctc
ctggaggagcgattccgggtggccatcaaggacaagcaagaaggaattgagtag

DBGET integrated database retrieval system