KEGG   Rattus norvegicus (rat): 288591Help
Entry
288591            CDS       T01003                                 

Gene name
Tmem120a, RGD1311474, Tmpit
Definition
(RefSeq) transmembrane protein 120A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TMPIT Hox9_act
Motif
Other DBs
NCBI-GeneID: 288591
NCBI-ProteinID: NP_001010945
RGD: 1311474
Ensembl: ENSRNOG00000001441
UniProt: Q5HZE2
Position
12q12
AA seq 343 aa AA seqDB search
MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRVKLEELTKLQDNCTNSITRQKKRLQE
LALVLKKCRPSLPSESLEAAQELESQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP
ECKEWQVLMCGLPFLLLFLGNFFTTLRVVHQKFHSQQHGSKKD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccccgcccccggacccgctgggcgactgcctgcgcaactgggaggatctgcag
caggacttccaaggtatccaggaaacacatcgcctgtaccgtgtcaagctagaggagctg
accaaactccaggacaactgtacaaactctatcacacgccagaagaagcggctccaggag
ctggccttggtgctgaaaaaatgcagaccctctctcccatccgagtccctggaggctgcc
caggagctggaaagccagataaaagagcgccaaggcctcttctttgacatggaagcctat
ctgcctaagaagaacgggttgtacctgagtctggttctggggaatgtcaacgtgacactt
ttgagcaagcaggctaagtttgcttacaaagacgagtatgagaaattcaagctctacctc
accatcatcctcattgtcatctccttcacctgccgcttcctgctcaactccagggtgaca
gacgctgccttcaacttcctgctggtctggtattactgcacgctgaccatccgggagagc
atcctcatcaataatggttccaggatcaaaggctggtgggttttccatcattatgtgtcc
acattcttgtcaggagtcatgctgacctggccagatggactcatgtaccagaagttccgg
aaccagttcctgtctttctccatgtaccagagttttgtgcagtttctgcagtattactac
cagagcgggtgcctttaccgcctgcgagccctgggcgaacgacacaccatggacctcact
gtggagggctttcagtcttggatgtggagaggcctcaccttcctgcttccgttcctcttc
tttggacatttctggcagctttttaatgcgctgacattgtttaacttggcccgggaccct
gagtgcaaggagtggcaggtgctcatgtgcggcctccccttcctcctcctcttcctcggc
aattttttcaccaccctccgagtggtgcatcagaagttccacagccagcaacacgggagc
aagaaggattaa

DBGET integrated database retrieval system