KEGG   Rattus norvegicus (rat): 288593Help
Entry
288593            CDS       T01003                                 

Gene name
Ccl24
Definition
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    288593 (Ccl24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    288593 (Ccl24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    288593 (Ccl24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    288593 (Ccl24)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   288593 (Ccl24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Ribosomal_L15e
Motif
Other DBs
NCBI-GeneID: 288593
NCBI-ProteinID: NP_001013063
RGD: 1310245
Ensembl: ENSRNOG00000031162
UniProt: Q5PPP2
Position
12q12
AA seq 119 aa AA seqDB search
MAGSTTIIASLLLLVACTCCICPTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPK
AGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctccaccaccatcattgctagccttctactcctggtagcctgcacgtgctgc
atctgccccacaggctctgtgaccatcccctcatcttgctgcgtgacctttatttccaag
aagattccagtaaaccgagtgattagctaccagttggccaatggcagcatctgtcccaag
gcaggggtcatcttcatcactaaaaagggccataagatctgtacggatcccaagttgcca
tgggttcagaagcacataaagaacctggatgccaagagaaaccagccttctgaaggtgcc
aaggccctgggtcccaagtttgtcatccagaaactccgaggcaatagcaccaaggtttag

DBGET integrated database retrieval system