KEGG   Rattus norvegicus (rat): 288615Help
Entry
288615            CDS       T01003                                 

Gene name
Sbds
Definition
(RefSeq) SBDS ribosome assembly guanine nucleotide exchange factor
  KO
K14574  ribosome maturation protein SDO1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    288615 (Sbds)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    288615 (Sbds)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    288615 (Sbds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBDS_C SBDS Dehydratase_SU 2-Hacid_dh_C MOLO1
Motif
Other DBs
NCBI-GeneID: 288615
NCBI-ProteinID: NP_001008290
RGD: 1311043
Ensembl: ENSRNOG00000000888
UniProt: Q5RK30
Position
12q12
AA seq 250 aa AA seqDB search
MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNV
SKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCV
NPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFLLPV
NEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLSLK
DVEEGDEKFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcacccccaccaaccagatccgactgaccaatgtagccgtggtgcggatg
aagcggggagggaagcgcttcgaaatcgcctgctataaaaacaaggtcgtcggctggcgg
agtggagtggaaaaagaccttgatgaagttctgcagacccattcagtgtttgtcaatgtt
tccaaaggtcaggttgccaagaaggaagacctcatcagtgcatttgggaccgacgaccag
actgaaatctgcaagcagattctgactaaaggagaagttcaagtgtcagataaagaacgg
cacacacagctggagcagatgtttagggatattgccaccattgtggcagacaagtgtgtg
aacccggaaacaaagagaccctacaccgttatcctcatcgagagagccatgaaggacatc
cactactccgtcaaacccaacaagagcaccaagcagcaggcgctggaggtgataaagcag
ctgaaggagaagatgaagatcgagagggcgcacatgcgcttgcgcttcctcctgccggtg
aacgagggaaagaagctgaaggaaaagctgaagcccctgatgaaggtcgtggagagtgag
gactacagccagcagctggagatcgtatgcctcatcgacccaggctgcttcagagaaatt
gacgagctgataaaaaaggaaacgaaaggcaagggttctctggaagtgctcagtctgaaa
gacgtggaggagggagatgagaagtttgaatga

DBGET integrated database retrieval system