KEGG   Rattus norvegicus (rat): 288617Help
Entry
288617            CDS       T01003                                 

Gene name
Tpst1
Definition
(RefSeq) tyrosylprotein sulfotransferase 1
  KO
K01021  protein-tyrosine sulfotransferase [EC:2.8.2.20]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    288617 (Tpst1)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.20  protein-tyrosine sulfotransferase
     288617 (Tpst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_3 Sulfotransfer_1 Sulfotransfer_4
Motif
Other DBs
NCBI-GeneID: 288617
NCBI-ProteinID: NP_001011903
RGD: 1308473
Ensembl: ENSRNOG00000000900
UniProt: Q3KR92
Position
12q12
AA seq 370 aa AA seqDB search
MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPARLENPKATVRTGLDIKAN
KTFTYHKNMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
KIRLDEAGVTDEVLDSAMQAFLLEVIVKHGEPAPYLCNKDPFALKSLTYLARLFPNAKFL
LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
QLVLHPERWMRTLLKFLHIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKILENTRRVHKGEFQLPDFL
KEKPQTEQVE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggttggaaagctgaagcagaacttgctcttggcgtgcctggtgattagttctgtgacc
gtgttttacctgggccagcatgccatggagtgccatcaccgaatagaggaacgtagccag
ccagccagactggagaaccccaaggcgactgtgcgaactggtctggacatcaaagccaac
aaaacgttcacctatcacaaaaatatgcctttaatattcatcggaggtgtgcctcggagc
ggaaccacactcatgagggctatgctggatgcacaccctgacatccgctgtggagaggaa
accagggtcatccctcgaatcctggccctgaagcagatgtggtctcgatccagtaaagag
aagatccgcctggatgaggctggcgtcacagatgaagtgctggattctgccatgcaagcc
ttccttctggaggtgatcgtgaaacatggggagccagcaccttatttatgtaacaaagat
ccctttgccctgaaatccttgacttaccttgctaggttattccccaatgccaaatttctc
ctgatggtccgagatggccgggcgtcagtacactcaatgatttctcggaaagttaccata
gctgggtttgacctgaacagctaccgggactgtctgaccaagtggaaccgggccatagag
accatgtacaaccagtgtatggaagttggctataagaaatgcatgttggtccactatgaa
cagctggtcttacaccctgaacggtggatgaggacgctcttaaagttcctccatattcca
tggaaccattcagttttacaccacgaagagatgatcgggaaagctgggggcgtttctctg
tcaaaagtggaaagatcaacagaccaagtcatcaagcccgtcaatgtgggggcactatcg
aagtgggttgggaagatacccccagatgtcttacaagacatggcagtgatcgcgcccatg
cttgccaaactgggatatgatccatacgccaatccccctaactacggaaaacctgacccc
aagatccttgaaaacaccaggagggtccataaaggagagtttcagctacctgactttctg
aaagaaaaaccccagaccgagcaagtggagtag

DBGET integrated database retrieval system