KEGG   Rattus norvegicus (rat): 288656
Entry
288656            CDS       T01003                                 

Gene name
Arl6ip4
Definition
(RefSeq) ADP-ribosylation factor like GTPase 6 interacting protein 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SR-25 Macoilin
Other DBs
NCBI-GeneID: 288656
NCBI-ProteinID: NP_001020801
RGD: 1307657
Ensembl: ENSRNOG00000001080
UniProt: Q4V8I5
Position
12q15
AA seq 231 aa
MAHVSSRKRSRSRSRSRGRRGSEKRSKRSSKDSSRNCSTSKSQGHKASSTSGVEERSKHK
AQRTSRSSSSSSSSSSSSSSSSTSSSSSSDGRKKRGKHKDKKKRKKKKKRKKKMKRKGKE
KAVVVHQAEALPGPSLDQWHRSAGEDNDGPVLTDEQKSRIQAMKPMTKEEWDARQSVIRK
VVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRAGLLP
NT seq 696 nt   +upstreamnt  +downstreamnt
atggctcacgttagctctcgcaagcgctcgagaagtcgcagtcggtcccgtggtcggcga
gggtcagaaaagcgaagtaagaggagcagtaaggactcctcgaggaactgttcaacctcc
aaatcccaaggtcacaaggccagcagcacctccggtgtcgaggagagaagcaagcacaag
gcccagaggacatcgagatccagctcttcctcctcctcctcctcctcttccagttcttct
agctccacctcatcctcatcctccagtgatggccggaagaagcgagggaagcacaaagat
aagaagaagaggaagaagaagaagaaacggaagaagaagatgaagaggaaaggcaaggag
aaggcagtggtggtgcaccaggccgaggctctgcccggcccctctctggatcagtggcac
agatcagctggggaggacaatgatggcccagtcctgacagacgagcagaagtctcgtatc
caggccatgaagcccatgacaaaggaggagtgggacgctcgacagagcgttattcgaaag
gtggtggacccagagaccggccgtacaaggctcatcaagggagacggtgaggttttagag
gagatcgtaaccaaagaacgacacagagagatcaacaagcaagccacccgaggggacggc
ctggccttccagatgcgagcaggcctgcttccctga

DBGET integrated database retrieval system