KEGG   Rattus norvegicus (rat): 288664Help
Entry
288664            CDS       T01003                                 

Gene name
Fam109a, RGD1310656
Definition
(RefSeq) family with sequence similarity 109, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_8 PH_11 PH_6
Motif
Other DBs
NCBI-GeneID: 288664
NCBI-ProteinID: XP_002724867
RGD: 1310656
Ensembl: ENSRNOG00000028206
UniProt: D3ZL52
Position
12q16
AA seq 234 aa AA seqDB search
MKLNERSLAFYATCDAPVDNAGFLYKRGGRGAGSHRRWFVLRGNILFYFESESSREPLGV
ILLEGCTVELVDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSRASFHYLRLVV
RELEQQLAAMREGSPANALPDANPSTVLNPKPKENGRAVWSALPEQPAVAPRRPPLPPRR
RASAANGPSVSFAQLHERYGLEVRALRNQWRGGLTSLEVPCHPGSGETQTQDQP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacgagcgcagcctggccttctacgcgacctgtgacgctccggtggacaat
gcgggcttcctgtacaaacgtggtgggcgtggggccggctcgcaccggcggtggttcgtg
cttcgcggcaacatactcttctacttcgagtcggaatcgagccgagagccactgggcgtc
atcctgctggagggctgcacggtggagctggtggacgcccgggaggagttcgccttcgcc
gtgcgctttgcgggtggccgttcccggccttatgtgctggcagcggacagccaggccgcc
ctggagggctgggtgaaggcactgtcccgggccagcttccactacctgcgcttggtggtg
cgtgagctggagcagcagctggcagccatgcgcgagggaagcccggccaacgccttaccc
gacgccaacccaagtacggttttgaacccgaaacccaaggagaacggccgggcggtgtgg
agcgctctgcctgagcaacccgctgtagccccccgccgcccaccactgccaccccgccgc
agggcctccgcggccaacgggccctcggtatccttcgcccagctgcatgagcgatacgga
ctcgaggtgcgggccctcaggaatcagtggcgtggaggcctcaccagcctggaagtcccc
tgccatcctggttctggtgagactcaaacccaggaccagccttaa

DBGET integrated database retrieval system