KEGG   Rattus norvegicus (rat): 288665Help
Entry
288665            CDS       T01003                                 

Gene name
Cux2, Cutl2
Definition
(RefSeq) cut-like homeobox 2
  KO
K09313  homeobox protein cut-like
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288665 (Cux2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Cut
    288665 (Cux2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUT Homeodomain Homeobox_KN DUF4618 MLTR_LBD DUF4407
Motif
Other DBs
NCBI-GeneID: 288665
NCBI-ProteinID: NP_001258309
RGD: 1305967
Ensembl: ENSRNOG00000001259
UniProt: F1M048
Position
12q16
AA seq 1426 aa AA seqDB search
MVAPVLKSFQAEVVALSKRSQEAEAAFLSVYKQLIEAPDPVPSVEVARTLDDRLQRPSFH
PSGQRLRDVHISWKRCPEPPSAREQNEGTCPTGHTPANGNHLPGPEDTLVTDTLLQKDEA
ERQKGLQEVHVTLAARLGEAEEKIKVLHSALKATQTELLELRRKYDEEAASKADEVGLIM
TNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPGGEKVSFALCSGPRLEAAL
ASKDREILRLLKDAQQLRHSLQELEEVSANQIADLERQLAAKSEAIEKLQEKLEAQADYE
EIKTELSILRAMKLASSTCSLPQALGKPDDPLLMAKDAFFPTQKLLLEKPALLASPEEDP
SEDDSIKGSLGMEPSYPPQLPPPPGPEDPLSPSPTQPLLGPSLGPDGPRTFSLSPFPSLA
PGERLAGDPLLSKHMMAPVAFKGETGNLLAFPPAFYGGAKPPTAPAAPVPGPEPSGAPEP
VDGAGPEEEQLDTAEIAFQVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILARPKPWRKLT
VKGKEPFIKMKQFLSDEQNVLALRTIQVRQRGSITPRIRTPETGSDDAIKSILEQAKKEI
ESQKGGESKNSPASVSIPNGTASSSTSEDAIKNILEQARREMQAQQQALLEMESGPRGRS
VPPSPPERPSPATMSQNGALACVKQEDGGCSSSSSGSAQAPLAVLSPAAFVQRIIRKVKS
EIGDAGYFDHHWASDRGLLSRPYASVSPSLSSSSSYSGQPNGRAWPRGDEATIAPEDEAA
TGMGEDEAPRVGELKAEAGVSEVGGGRLPYYPAYVPRTLKPTVPPLTPEQYELYMYREVD
TLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQL
WLSDQLGQGQAPNQQPSASQASPTEPTSSPSPPPSPTEPEKTSQEPLGLSLESSKENQQP
EGRASSTLGGKPLSSSQTTGGIQEMVAMSPELDTYSITKRVKEVLTDNNLGQRLFGESIL
GLTQGSVSDLLSRPKPWHKLSLKGREPFVRMRLWLSDPHNVEKLRDVKKLEKKAYLKRRY
GLISTGSDSESPAAHSECPSPCLQPQELSLMQAKKPRVVLAPAEKEALRKAYQLEPYPSQ
QTIELLSFQLNLKTNTVVNWFHNYRSRMRREMLVEGTQDDPDFDPSGGSSVLPSGHTHTD
PTPQSPDSEIEDQKPPMKSLELQEPESPVHQAAPDRAVVKIKQEEGLEVDGDSQPQDIGD
PDRGQGGPKEEDTHPLGNNELSELVPGPFLPGTPNPDCSSLHTPQAKETGEQVHSEPLSF
KSTSESSCCSLEGPPNSPSAISSPDLMTCVSPAPSSSAPISPSLPGTLPAKVPSTSPTAD
PAAALHPSTKVNPNLQRRHEKMANLNSIIYRLERAANREEALEWEF
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atggtagccccagtgctgaaaagcttccaagctgaggtggtggctctcagtaagagaagt
caggaggcagaggcagcattcctgagtgtttataagcaattaattgaagcgccagaccct
gtcccgtcggttgaggtggcgcggactctagacgacagactgcagcgtcccagcttccac
cccagtgggcagcgcctacgagacgtgcacatctcgtggaagaggtgcccagagccaccc
agtgccagagagcagaacgaggggacgtgtcccaccgggcacacgccagccaacggtaac
cacctgccaggtcccgaggacaccctcgtgacagacaccttgctgcagaaggatgaggcc
gagagacagaagggcctccaagaagtccacgtcaccttggcagccaggctgggggaggca
gaggagaaaatcaaggtgttacattcagcgctaaaggccacacagacggagctgctggag
ctgaggaggaaatacgatgaggaggctgcatccaaggccgatgaggtcggcttgatcatg
acgaacctggagaaggccaaccagcgagcagaggctgcccagcgggaggtagaaagcctc
cgggagcagctggcatcggtcaacagctccattcgcctggcttgctgctccccgcaggga
cccggtggggagaaggtgagcttcgccctgtgctcagggccccggctggaggcagcgctg
gcttccaaggacagggagatcctcaggctgctgaaggacgcccagcagctgcggcactct
ctgcaggagctggaagaggtctcagccaaccaaatcgctgatctggagcggcagctagcg
gccaagtctgaggccatagagaaactccaagaaaagctggaggcccaggctgactatgaa
gagattaaaacagagctgagcatcctgagagccatgaagctggcctccagcacgtgcagc
ctcccacaggcgctgggcaagcctgacgacccactgctcatggccaaggatgccttcttc
cccacacagaagctcctgctggaaaagcccgcgctgctggccagccctgaggaggacccc
tcggaggatgactctatcaagggctcactgggcatggagccctcctaccctcctcagctt
ccacctccgccaggccctgaagacccgctgtccccaagccctacgcagcccctgctgggc
cccagcctgggtcctgatggaccaaggactttctcgctgtcccccttccccagcctggca
ccgggggagaggctggctggggacccactgctgtccaaacatatgatggccccagttgcc
ttcaaaggggaaacgggcaacctgctggcattcccaccggccttctatggcggtgccaag
cctccaacggctcctgccgccccagtgcccggccctgagccctctggggccccagagcct
gtggacggggctgggccagaggaggagcagctggacacggccgagatcgccttccaggtg
aaggagcagcttctgaagcacaacattggccagcgtgtgtttggccactatgtgctggga
ctgtcgcagggctcggtgagtgagatcctggcacggcccaagccgtggcgcaagctcacg
gtgaagggcaaggagcccttcatcaagatgaagcagttcctgtcggatgagcagaacgtg
ctggccctgcgcaccatccaggtgaggcagcgaggcagcatcaccccgagaatccgaact
cctgagaccggctcagacgacgccatcaagagtatcctggagcaggccaagaaggagatt
gagtctcagaaagggggtgagtccaagaactcccctgcctccgtgagcatccccaacggc
acagcttcctccagcacctcggaagacgccatcaagaacattctggaacaagcccgccgc
gaaatgcaagcccagcagcaggccctgctggagatggagtcgggtcccaggggccgctca
gtgcctccctctcctccggagcggccctcgccagccactatgagccagaatggggccctg
gcctgcgtgaagcaggaagacggcggctgcagcagcagcagtagcggcagtgcgcaggcg
ccgcttgctgtcctgtcccccgctgcatttgtgcagcggatcatccgcaaggtgaagtca
gagatcggcgacgctggctactttgatcaccactgggcatcagaccgtggtctgctcagc
cgtccctacgcctccgtgtcaccttccctctcctcctcctccagctactcgggacagccc
aatgggcgagcctggccccgtggggacgaggcaaccattgcccctgaggacgaagcggct
acgggcatgggggaggacgaggcccccagggtgggagagctcaaggccgaggccggagtc
tccgaggtgggtggcgggcgactgccctactacccagcgtatgtgccccgcacactcaag
cccactgtgccgcccctaacacccgagcaatacgagctatacatgtaccgggaggtagac
actctggagctcacccgccaggtcaaggagaagctagccaagaacggcatctgccagcgc
atctttggggagaaggtcctgggactgtctcagggcagcgtgagtgacatgctgtcacgg
ccaaagccatggagcaagctgacacagaagggccgggagcctttcatccgcatgcagttg
tggctatcagaccagctgggccagggccaggccccaaaccagcagcccagcgctagccag
gccagccccacggagccaacgtcctcaccatcacctcccccaagccccacggagcctgaa
aagacttcccaggagcctctgggcctgtccctagaaagcagcaaggagaatcagcaacca
gagggccgggccagctccaccctgggtgggaagcccctctcaagcagccagactacgggg
ggcatccaggagatggtggccatgtccccagagctggacacatactccatcaccaagaga
gtcaaggaggtcctcacggacaacaacctagggcagcggttgtttggtgagagcatcctg
gggctaacacagggctccgtgtcagacctgctgtcgaggcccaagccctggcacaagctg
agcttgaagggccgggagccctttgtgcgcatgcggctgtggctgagcgacccccacaat
gtggaaaagcttcgagatgtgaagaagctggagaagaaagcctatctgaaacgccgatac
gggctcatcagcacgggctctgacagcgagtcaccggcagctcactccgagtgtcccagc
ccatgtctgcagccgcaggagttgagcctcatgcaggccaagaagccacgtgtggtgctg
gcaccggccgagaaggaggctctgcggaaggcctaccagctagagccctacccctcacag
cagaccatagagttgctctctttccagctcaacctcaagacaaacactgtcgtcaactgg
ttccacaactacaggtccaggatgcgccgggagatgctggtggagggaacacaggatgac
ccagactttgacccaagtgggggctccagtgtcctgccatcaggccacacccacacagac
cccaccccgcagagccctgactcagagattgaggaccaaaagccccccatgaagagcctg
gagctgcaggaacctgagagtcccgtacaccaagcagccccagacagggctgtggtgaag
attaagcaggaagagggtttagaggtggatggggacagccagccccaggacataggggat
ccagacagagggcaaggtggccccaaagaggaggatactcaccctctggggaacaatgaa
ctctcagagctggtccccgggcctttccttccaggcacacccaatccagactgctcttca
ttgcacaccccccaagcaaaagagactggggaacaggttcactcagagcctctgagtttc
aagtccacctctgaatcctcatgctgcagcctggaggggccaccgaactctccctctgcc
atctcctcgccagacctcatgacatgtgtgtcacccgccccttcctcctcagcccccatc
tccccatccctacctggcaccctacctgccaaagtgccgagtaccagtcccactgctgac
ccagctgcagccttgcaccccagcactaaggtgaaccccaacttgcagcggcggcatgag
aaaatggccaacttgaacagtataatctaccgactggagagggctgccaaccgggaagag
gctctggagtgggaattctga

DBGET integrated database retrieval system