KEGG   Rattus norvegicus (rat): 288669
Entry
288669            CDS       T01003                                 

Gene name
Arpc3
Definition
(RefSeq) actin-related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    288669 (Arpc3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    288669 (Arpc3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    288669 (Arpc3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    288669 (Arpc3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    288669 (Arpc3)
   05135 Yersinia infection
    288669 (Arpc3)
   05100 Bacterial invasion of epithelial cells
    288669 (Arpc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288669 (Arpc3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    288669 (Arpc3)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    288669 (Arpc3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     288669 (Arpc3)
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 288669
NCBI-ProteinID: NP_001099403
RGD: 1311985
Ensembl: ENSRNOG00000008673
UniProt: B2GV73
Position
12
AA seq 178 aa
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSRSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ASKQEDETMRAYLQQLRQETGLRLCDKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggaccctgacaccaagctcattggcaacatggca
ctgctgcccatccgaagccagttcaaaggacccgcccctcgagagacgaaagacacggat
attgtggatgaagccatctattacttcaaggccaacgtcttcttcaagaactatgaaatt
aagaatgaagcggacaggaccttgatctacatcacactctacatttctgagtgtctaaag
aagctccaaaagtgcaactccagaagccaaggcgagaaagaaatgtacacgctaggaatc
accaactttcccattcctggcgagcctggctttcccctcaacgccatttacgccaaacct
gccagcaaacaggaggatgaaacgatgcgcgcgtacctacagcagctgaggcaagagacc
ggactgaggctttgtgacaaagtttttgaccctcagaatgataaaccaagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcggggcccgggcagtga

KEGG   Rattus norvegicus (rat): 289820
Entry
289820            CDS       T01003                                 

Gene name
Actr2
Definition
(RefSeq) actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    289820 (Actr2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    289820 (Actr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    289820 (Actr2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    289820 (Actr2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    289820 (Actr2)
   05135 Yersinia infection
    289820 (Actr2)
   05100 Bacterial invasion of epithelial cells
    289820 (Actr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289820 (Actr2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    289820 (Actr2)
   04147 Exosome [BR:rno04147]
    289820 (Actr2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    289820 (Actr2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     289820 (Actr2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   289820 (Actr2)
  Exosomal proteins of other body fluids (saliva and urine)
   289820 (Actr2)
  Exosomal proteins of bladder cancer cells
   289820 (Actr2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 289820
NCBI-ProteinID: NP_001009268
RGD: 1310826
Ensembl: ENSRNOG00000004959
UniProt: Q5M7U6
Position
14
AA seq 394 aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRSCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcactgggtttgtgaagtgt
ggatatgcaggctctaactttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggatctcatggttggcgatgag
gcaagtgagctgcgctccatgttggaggtgaactacccgatggagaacggcatcgtgcgc
aactgggacgacatgaagcacctgtgggactacacattcgggccagagaagctcaatata
gacaccaggagctgcaagatcttacttacagaacccccaatgaatccaaccaagaacaga
gagaagattgtcgaggtaatgtttgaaacttaccagttttctggtgtgtatgtagccatc
caagcagttctgactttgtatgctcaaggtttactgactggtgtggtagtggactctgga
gatggtgtcactcacatttgcccagtatatgaaggcttttccctccctcaccttacaagg
aggctggatattgctgggagggatattaccaggtatcttatcaagctgctgctgttgcga
ggatatgccttcaaccattctgctgactttgagacagttcgcatgattaaagaaaaactt
tgttatgtgggttacaatattgagcaagagcagaagctggccttagagaccacagtgcta
gttgagtcatacactcttccagatggacgtattattaaggttggaggagaaagatttgaa
gcaccagaagctttatttcagcctcatttgatcaatgttgagggggttggtgttgctgaa
ttgctttttaacacaatccaggcagccgacattgataccagatctgaattttataagcac
attgtgctttctggaggttctaccatgtatcctggcctgccatcgaggttggaacgagag
cttaaacagctttacctagaacgagttctgaaaggagatgtggagaaactttcgaaattt
aagatccgcattgaagacccgcctcgcaggaagcacatggtgttcttgggtggcgcagtc
ctagcagacatcatgaaagacaaagacaacttctggatgaccagacaagagtaccaagaa
aagggtgtccgtgtgctggagaaactcggtgtgactgttcgataa

KEGG   Rattus norvegicus (rat): 296710
Entry
296710            CDS       T01003                                 

Gene name
Arpc5l
Definition
(RefSeq) actin-related protein 2/3 complex subunit 5-like protein
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    296710 (Arpc5l)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    296710 (Arpc5l)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296710 (Arpc5l)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    296710 (Arpc5l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    296710 (Arpc5l)
   05135 Yersinia infection
    296710 (Arpc5l)
   05100 Bacterial invasion of epithelial cells
    296710 (Arpc5l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296710 (Arpc5l)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296710 (Arpc5l)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    296710 (Arpc5l)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     296710 (Arpc5l)
SSDB
Motif
Pfam: P16-Arc Utp12
Other DBs
NCBI-GeneID: 296710
NCBI-ProteinID: NP_001032856
RGD: 1308867
Ensembl: ENSRNOG00000014317
UniProt: A1L108
Position
3
AA seq 153 aa
MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAASGEPGPDPCEVDGLLRQGDMLRAFHAA
LRNSPINTKNQAVKERAQGIVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPT
ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcccggaacacactgtcctcacgcttccgccgagtggatatcgacgaatttgacgag
aacaaattcgtagacgagcacgaagaggcggcggcggcgtcgggcgagccaggccccgac
ccctgcgaggtagacgggctcctgcggcaaggggacatgcttcgggcattccatgcagcc
ttgcggaactctccaatcaacaccaagaatcaagctgtgaaggaacgagcccagggtata
gtcctgaaagtactcacaaacttcaagagcagcgagattgagcaggctgtgcagtcactg
gacaggaatggcattgacttgctaatgaagtacatttataaagggtttgagaagcccaca
gaaaatagcagtgcagtgttactccagtggcatgaaaaggctttagctgttggaggacta
ggctccattataagagttcttacagcaagaaagactgtttaa

KEGG   Rattus norvegicus (rat): 297518
Entry
297518            CDS       T01003                                 

Gene name
Arpc4
Definition
(RefSeq) actin-related protein 2/3 complex subunit 4
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    297518 (Arpc4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    297518 (Arpc4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    297518 (Arpc4)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    297518 (Arpc4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    297518 (Arpc4)
   05135 Yersinia infection
    297518 (Arpc4)
   05100 Bacterial invasion of epithelial cells
    297518 (Arpc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297518 (Arpc4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    297518 (Arpc4)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    297518 (Arpc4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     297518 (Arpc4)
SSDB
Motif
Pfam: ARPC4 Sm_like Cmr7A
Other DBs
NCBI-GeneID: 297518
NCBI-ProteinID: NP_001100085
RGD: 1310096
Ensembl: ENSRNOG00000008994
UniProt: B2RZ72
Position
4
AA seq 168 aa
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgactgccactctccgcccctaccttagtgccgtgcgggccacactgcaggccgccctc
tgcctggagaacttctcttcccaggtcgtggaacgacacaacaagccagaggttgaagtc
aggagtagcaaagaactcctattgcaacctgttaccatcagcaggaatgagaaggaaaag
gttctgattgaaggctccatcaattctgtccgggtcagcattgctgtgaaacaggctgat
gagattgagaagattttatgccataaattcatgcgcttcatgatgatgcgagcagagaac
ttctttatccttcgaaggaaacctgtggagggttatgacatcagctttctcatcaccaac
ttccatacggagcagatgtacaaacacaaactggtggactttgtaatccacttcatggag
gagatcgacaaggagatcagtgagatgaaactgtcagtcaatgcccgggctcgtatcgtg
gctgaggagttcctcaagaacttttag

KEGG   Rattus norvegicus (rat): 301511
Entry
301511            CDS       T01003                                 

Gene name
Arpc2
Definition
(RefSeq) actin-related protein 2/3 complex subunit 2
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    301511 (Arpc2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    301511 (Arpc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    301511 (Arpc2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    301511 (Arpc2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    301511 (Arpc2)
   05135 Yersinia infection
    301511 (Arpc2)
   05100 Bacterial invasion of epithelial cells
    301511 (Arpc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    301511 (Arpc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    301511 (Arpc2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    301511 (Arpc2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     301511 (Arpc2)
SSDB
Motif
Pfam: P34-Arc ARPC4
Other DBs
NCBI-GeneID: 301511
NCBI-ProteinID: NP_001100389
RGD: 1305848
Ensembl: ENSRNOG00000014289
Vega: OTTRNOG00000001501
UniProt: A0A0G2K9A2
Position
9
AA seq 300 aa
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
NT seq 903 nt   +upstreamnt  +downstreamnt
atgatcctgctggaggtgaacaaccgcatcatcgaggagacgctcgcgctcaagttcgag
aacgcggccgccggaaacaaaccagaagctgtagaagtaacatttgcagattttgatggc
gtcctttatcatatttcaaatcctaatggagacaaaacaaaagtgatggtcagtatttct
ttgaaattctacaaggaacttcaggcacacggagctgatgagttactaaagagagtatac
ggaagtttcttggtgaacccagaatcaggatacaatgtgtctttgctatatgacctggaa
aatctacctgcatccaaggattctattgtgcatcaggctggcatgttgaagcgaaattgt
tttgcctctgtgtttgagaaatacttccaattccaagaagagggcaaagaaggagagaac
agagcagttatccattatagagatgatgagaccatgtatgtggaatctaaaaaagacaga
gtcacagtagtcttcagcacagtttttaaggatgacgacgatgtggtcattggaaaggtg
ttcatgcaggagttcaaagaaggacgaagagccagccacacagccccccaggtccttttt
agccacagggaacctcctctagaactgaaagacacagatgctgccgtgggtgacaacatt
ggctacatcacctttgtgctgttccctcgccacaccaatgccactgctcgagacaacacc
atcaacctgatccacacgttccgggactatctgcactaccacattaagtgctctaaggcc
tatattcatacacgaatgcgagcaaaaacatccgacttccttaaggtgctcaaccgtgca
cgcccagatgccgagaaaaaagaaatgaaaacaatcacggggaagactttttcatcccgc
taa

KEGG   Rattus norvegicus (rat): 360854
Entry
360854            CDS       T01003                                 

Gene name
Arpc5
Definition
(RefSeq) actin-related protein 2/3 complex subunit 5
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    360854 (Arpc5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    360854 (Arpc5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360854 (Arpc5)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    360854 (Arpc5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    360854 (Arpc5)
   05135 Yersinia infection
    360854 (Arpc5)
   05100 Bacterial invasion of epithelial cells
    360854 (Arpc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360854 (Arpc5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    360854 (Arpc5)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    360854 (Arpc5)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     360854 (Arpc5)
SSDB
Motif
Pfam: P16-Arc UTP15_C Utp12
Other DBs
NCBI-GeneID: 360854
NCBI-ProteinID: NP_001020888
RGD: 1311791
Ensembl: ENSRNOG00000028062
Vega: OTTRNOG00000002085
UniProt: Q4KLF8
Position
13
AA seq 151 aa
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALK
NPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDN
SSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtcgaagaacacggtgtcgtcggcccgcttccggaaggtggacgtggacgaatatgat
gagaacaagttcgtggacgaggaggacggcggcgatggccaggccgggcccgacgagggc
gaggtggactcatgcctacggcaaggaaacatgaccgctgccctacaggccgctctgaaa
aacccccccattaacacaaagagccaggcagtgaaggaccgggcaggcagcatcgtcttg
aaggtgctcatctcctttaaagctaatgatattgaaaaggctgttcagtctctggacaag
aatggcgtggacctcctaatgaagtatatttataaaggctttgagagcccgtctgacaat
agcagcgctatgttactacagtggcatgaaaaggcacttgctgctggaggagtagggtct
atcgttcgtgttttgactgcaagaaaaaccgtgtag

KEGG   Rattus norvegicus (rat): 362298
Entry
362298            CDS       T01003                                 

Gene name
Actr3b
Definition
(RefSeq) actin-related protein 3B
  KO
K18584  actin-related protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    362298 (Actr3b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    362298 (Actr3b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    362298 (Actr3b)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    362298 (Actr3b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362298 (Actr3b)
   05135 Yersinia infection
    362298 (Actr3b)
   05100 Bacterial invasion of epithelial cells
    362298 (Actr3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362298 (Actr3b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362298 (Actr3b)
   04147 Exosome [BR:rno04147]
    362298 (Actr3b)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    362298 (Actr3b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     362298 (Actr3b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362298 (Actr3b)
  Exosomal proteins of other body fluids (saliva and urine)
   362298 (Actr3b)
  Exosomal proteins of bladder cancer cells
   362298 (Actr3b)
SSDB
Motif
Pfam: Actin MreB_Mbl KilA-N ALP_N Robl_LC7
Other DBs
NCBI-GeneID: 362298
NCBI-ProteinID: NP_001178789
RGD: 1565759
Ensembl: ENSRNOG00000031855
Position
4
AA seq 418 aa
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIVEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQRKFIIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKP
KPVEVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggctcgctgcctccctgcgtggttgactgcggcaccgggtacaccaagctcggc
tacgcaggcaacactgagccacagttcattattccgtcatgtattgccatccgagagtcg
gcaaaggtagttgaccaagcccagaggagggtgttgagaggagttgatgaccttgacttc
ttcataggggatgaagccattgataaacctacctacgctaccaagtggcctatacgacat
ggcatcgttgaagactgggatcttatggaaaggttcatggaacaggtggtctttaagtat
ctccgtgccgaacctgaggaccattattttttaatgacagaacctccactgaacacacca
gagaacagagagtaccttgcagaaatcatgtttgaatcatttaatgtaccagggctctac
attgcagtacaggcagtgctggccctggcggcctcttggacatcccggcaagttggtgaa
cgcaccctgacggggatagtcatagacagtggagatggcgtcacccatgttatcccggtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccaattgcaggtagagatatt
acgtatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaagtactgttacatatgccctgatattgtcaag
gaatttgctaaatatgacgtggatccccggaagtggatcaaacagtatacagggatcaat
gcaatcaaccagaggaagttcattatagatgttggttatgagaggttcctgggaccagaa
atattctttcaccctgagtttgccaacccagactttatggagtccatctcggatgtcgtt
gatgaagtcatacagaactgtcccatagacgtgcgccgaccgctgtataagaacatcgtt
ctctctggaggctccacaatgttcagagattttggacgccgtctgcagagagatttgaag
agagtggtggacgccaggttaaagctgagccaagagctcagcgggggcaggataaagcct
aagcctgtggaggtgcaggtgatcacacaccacatgcagcgctacgccgtctggtttgga
ggctctatgctcgcctcgactccggagttctttcaggtctgccacaccaagaaggactat
gaggaatacggccccagcatctgccgccacaaccccgtcttcggagtcatgtcctag

KEGG   Rattus norvegicus (rat): 54227
Entry
54227             CDS       T01003                                 

Gene name
Arpc1b
Definition
(RefSeq) actin-related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    54227 (Arpc1b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54227 (Arpc1b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54227 (Arpc1b)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    54227 (Arpc1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    54227 (Arpc1b)
   05135 Yersinia infection
    54227 (Arpc1b)
   05100 Bacterial invasion of epithelial cells
    54227 (Arpc1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    54227 (Arpc1b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    54227 (Arpc1b)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    54227 (Arpc1b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     54227 (Arpc1b)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 54227
NCBI-ProteinID: NP_062162
RGD: 2155
Ensembl: ENSRNOG00000000991
Vega: OTTRNOG00000000692
UniProt: O88656
Position
12
AA seq 372 aa
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWNKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSAGGSRVAWVSHDSTVCLVDAEKKMAVATL
ASETLPLLAITFITENSLVAAGHDCFPVLFTYDNAAGTLSFGGRLDVPKQNSQRGLTARE
RFQNLDKKASSEGGAATGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIR
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcttaccacagcttcctggtggaacccatcagctgccatgcctggaacaaggaccgt
actcagatcgccatctgccccaacaaccacgaggtgcacatctacgagaagagcggtgcc
aagtggaacaaggtgcacgagctcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgcattgtgacctgcggcacagaccgcaatgcctatgtgtggacg
ctgaagggccgcacgtggaagcccacgctggtcatccttcggattaatcgagctgcccgc
tgcgtgcgctgggcccccaatgagaacaagttcgccgtgggcagtggctcccgtgtcatt
tccatctgttattttgagcaggagaatgactggtgggtgtgcaaacacatcaaaaagccc
atccgctccactgtccttagcctggactggcaccccaacaacgtgctcctggctgcaggc
tcctgtgacttcaagtgcaggatcttctctgcctatatcaaggaggtggaggaacggcca
gcccctacaccgtggggctccaagatgccctttggggagctgatgtttgaatcgagcagc
agctgtggctgggtgcatggtgtctgcttctcggccggtgggagccgagttgcttgggtc
agccatgacagcactgtgtgcctggtagatgctgagaagaagatggccgtggcaaccctg
gcctctgagacattaccgctcctggccatcaccttcatcacagaaaatagtctcgtggca
gcgggccacgactgcttcccggtgctgtttacctatgacaacgctgcggggacattgagc
tttggtggccggctggatgtgcccaagcagaactcccagcgtggcctgacagcccgagag
cgcttccagaacctcgacaagaaggccagctctgaagggggtgcagccacaggggctggc
ctggattcactgcacaagaacagcgtcagtcaaatctcggtgctcagcgggggcaaggcc
aagtgctcgcagttctgcaccacaggcatggacggtggcatgagcatctgggatgtgaag
agcttggagtcagccttgaaggacctgaagatcagatga

KEGG   Rattus norvegicus (rat): 81732
Entry
81732             CDS       T01003                                 

Gene name
Actr3
Definition
(RefSeq) actin-related protein 3
  KO
K18584  actin-related protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81732 (Actr3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    81732 (Actr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81732 (Actr3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    81732 (Actr3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81732 (Actr3)
   05135 Yersinia infection
    81732 (Actr3)
   05100 Bacterial invasion of epithelial cells
    81732 (Actr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81732 (Actr3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81732 (Actr3)
   04147 Exosome [BR:rno04147]
    81732 (Actr3)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    81732 (Actr3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     81732 (Actr3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81732 (Actr3)
  Exosomal proteins of other body fluids (saliva and urine)
   81732 (Actr3)
  Exosomal proteins of bladder cancer cells
   81732 (Actr3)
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N Robl_LC7
Other DBs
NCBI-GeneID: 81732
NCBI-ProteinID: NP_112330
RGD: 71024
Ensembl: ENSRNOG00000003206
UniProt: Q4V7C7
Position
13
AA seq 418 aa
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacgggatatacaaaactagga
tatgctggaaatacagaaccacagtttatcatcccatcatgtattgccattaaagagtct
gcaaaagtgggtgatcaagcccagaggagggtgatgaaaggcgtggatgacctagacttc
ttcattggtgatgaagcaatagaaaagcccacatatgcaacaaagtggccaatccgccat
ggtatagttgaagactgggacttaatggaaaggtttatggagcaagtgatttttaaatat
ttaagggcagaacctgaagatcattactttcttttgactgaacctccactgaatactcca
gaaaacagggaatatactgctgagataatgtttgagtccttcaatgttccaggcctgtac
attgctgtgcaggctgttcttgccttagctgcatcctggacctcaagacaagtaggagag
cggacactgacgggtacagtaatagacagtggagacggagtcactcatgtcattcctgtg
gctgaaggatatgttatcggcagctgtattaaacacattccaatcgctggaagagatata
acatattttattcagcaactgctgagagaccgagaagtaggaatccctcctgaacagtcc
ttggaaactgcaaaagcagtgaaggagcgctacagttatgtctgcccagatttagtaaaa
gaatttaacaagtatgacactgatgggtcaaagtggatcaaacagtacaccggagtcaac
gccatctcaaagaaggaattctccattgatgttggctacgagcgatttctgggaccggag
atctttttccatccagagtttgctaatccagattttacacaacctatctcagaagttgta
gatgaagtcattcagaattgccccattgatgtccggcgtcctctctacaagaacattgtc
ctctctggtggttcaaccatgttcagggactttggacgtcgtttgcaaagagatctgaag
agaactgtagatgccaggctgaagttgagtgaggagctgagcggtggcagattgaagccc
aagcctattgatgtacaagttattacacaccacatgcagcggtatgcagtctggtttgga
ggatcaatgctggcttccacgcctgagttctaccaagtatgccacaccaaaaaggattat
gaagaaatcggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcctaa

KEGG   Rattus norvegicus (rat): 81824
Entry
81824             CDS       T01003                                 

Gene name
Arpc1a
Definition
(RefSeq) actin-related protein 2/3 complex subunit 1A
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81824 (Arpc1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    81824 (Arpc1a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81824 (Arpc1a)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    81824 (Arpc1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81824 (Arpc1a)
   05135 Yersinia infection
    81824 (Arpc1a)
   05100 Bacterial invasion of epithelial cells
    81824 (Arpc1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81824 (Arpc1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81824 (Arpc1a)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    81824 (Arpc1a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     81824 (Arpc1a)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 LytB_WW
Other DBs
NCBI-GeneID: 81824
NCBI-ProteinID: NP_112408
RGD: 620834
Ensembl: ENSRNOG00000000996
Vega: OTTRNOG00000000693
UniProt: Q99PD4
Position
12
AA seq 370 aa
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWTKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLRTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDVPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtctctgcatcagtttctgctagagccaatcacctgccatgcctggaacagggatcgg
acccagatcgcactgagccccaataatcatgaagtgcacatctacaagaagaatgggagt
cagtggacgaaagctcacgagctgaaggaacataacggacacatcacaggtattgactgg
gctcctaagagcgaccgtattgtcacttgtggggcggaccgcaacgcctatgtctggagt
cagaaagatggcatctggaagccgaccctggtgatcctgaggattaaccgtgcagccact
ttcgtgaagtggtctccactcgagaacaagtttgctgtggggagtggagcccggctcatc
tctgtctgctactttgagtctgaaaatgactggtgggtcagcaagcacattaagaagccg
atccgctccacagtcctcagcctggactggcatcccaacaacgttttgctggctgcaggc
tcctgtgacttcaaatgcagagtattttcggcctacatcaaagaggtggatgagaagcca
gccagcacgccctggggcagcaagatgccttttggtcagctgatgtctgagtttggtggc
agtggcactggtggctgggtgcacggggtcagcttctctgccagtgggagccggctggcc
tgggtcagccacgacagcacagtgtctgtcgctgatgcctcaaaaagtgtgcaggtttca
actctgagaacggagttcctgccgctgctcagtgtgtcatttgtctcagagaacagcgtt
gtggctgccggccatgactgctgcccgatgctctttaactacgatgaccgtggctgtttg
acctttgtgtccaagctagacgtcccaaaacagagcatccagcgcaacatgtctgctatg
gaacgcttccgtaacatggataagagggccactaccgaggaccgcaacacagccttggaa
acactgcaccagaacagcatcactcaagtgtctatttatgaagtggacaagcaagattgt
cgcaaattttgcactactggcatcgatggagccatgacaatctgggatttcaagactcta
gagtcttccatccagggtctccggataatgtga

DBGET integrated database retrieval system