KEGG   Rattus norvegicus (rat): 288671
Entry
288671            CDS       T01003                                 

Gene name
Anapc5
Definition
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04657  IL-17 signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    288671 (Anapc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    288671 (Anapc5)
   04114 Oocyte meiosis
    288671 (Anapc5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    288671 (Anapc5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    288671 (Anapc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    288671 (Anapc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    288671 (Anapc5)
   03036 Chromosome and associated proteins [BR:rno03036]
    288671 (Anapc5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     288671 (Anapc5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    288671 (Anapc5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_7 YycI MapZ_EC1
Other DBs
NCBI-GeneID: 288671
NCBI-ProteinID: NP_001073616
RGD: 1306125
Ensembl: ENSRNOG00000001316
UniProt: A1L1K3
Position
12
AA seq 727 aa
MMTNGVVHANLFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLVERRKLNQLLLPLLQGPD
ITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDLEQFFDDLSDSFSGTEPEVHKTSVV
GLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMDREDGERQMEKEELDVS
VREEEVSCSGPLSQKQAEFFLSQQAALLKNDETKALTPASLQKELNNLLKFNPDFAEAHY
LSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSLRYAALNLAALHCRFG
HYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVLLEHSVKKAVHFGLPR
AFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSM
NSLESLSAGVQQNNTESFAVALCHLAELHAEQGCFAAAGEVLKHLKERFPPNSQHAQLWM
LCDQKIQFDRAMNDGKFHLADSLVTGITALNGIEGVYRKAVVLQAQNQMTEAHKLLQKLL
TYCQKLKNTEMVISVLLSVAELYWRSSSPTIAMPVLLEALALSKEYRLQYLASETVLNLA
YAQLILGIPEQALTLLHMAIEPILADGAILDKGRAMFLVSKCQVASAASYDPVKKAEALE
AAIQNLTEAKNYFAKVDCRERIRDVSYFQARLYHALGKTQERNHCAMVFRQLHQELPSHG
VPLINHL
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgatgaccaacggggtagtgcacgccaacttgtttggcatcaaggactgggtgacgccc
tataagatcgcggtcctggtgctgctgaacgagatgggccgcacgggagagggtgctgtc
agccttgtggagcggcggaagctcaaccagctgctcctgcccctgctgcagggcccagat
attacactgtcaaagctgtacaaactaattgaagaatcgtgtcctcagctggcaaattca
gtgcagatcagaatcaaactgatggctgaaggcgaattgaaggatctggaacaatttttt
gatgacctttcagattctttttctggaactgaaccagaggttcacaaaacaagtgtagta
ggtctgtttctgcgtcacatgatcttggcctacagcaagctttccttcagtcaagtgttc
aagctgtacactgccctgcagcagtatttccagaacggggagaaaaagacggtggaagac
gctgacatggacagagaggatggagagagacagatggagaaggaggagctcgacgtatct
gtcagagaagaggaggtatcttgcagtggtcctctgtcccaaaaacaagcagaatttttt
ctttctcagcaggctgctttgttgaagaatgacgagactaaagccctcaccccagcctcc
ttgcagaaggagttgaacaacctgttgaaatttaatcctgattttgctgaagctcattac
ctcagctacttaaacaacctccgtgttcaagatgttttcagctcaacgcacagcctcctt
cattattttgaccgcctgattctcactggagcagagggcaaaagtaatggggaagaaggt
tatggccggagcctaagatacgccgctctcaacctggctgccctgcactgccgcttcggc
cactatcaacaggcagagctcgccctgcaggaggcaattaggattgcccaggagtccaac
gatcacgtgtgtctgcagcactgtttgagctggctttatgtgctggggcagaagagagcc
gatagctatgttctgctggagcattctgtgaagaaagcagtgcattttgggttaccgaga
gcttttgctgggaagacggccaacaaactgatggatgccctaaaggactctgacctcctg
cactggaaacacagcttgtcagaacttatcgacatcagcatcgcacagaaaacggccatc
tggaggctgtacggccgcagcaccatggcactgcagcaagcccagatgctgctgagcatg
aacagcctggagtcactgagtgcaggtgtgcaacagaacaacaccgagtcctttgccgtc
gctctctgccatcttgcagagctgcatgcagaacagggctgtttcgctgctgccggggaa
gtactgaagcacttgaaggaacggttcccacccaacagtcagcacgcccagttatggatg
ctgtgtgatcaaaaaatacagtttgacagagcaatgaatgatggtaaattccatttggct
gactcgcttgttacaggaatcacagcacttaatggcatagaaggagtatacagaaaagca
gtggtgctgcaagctcaaaaccagatgacagaggcacacaagcttttgcagaagttgctg
acatactgtcagaagttgaagaacacagagatggtcatcagcgtcctcctgtcggtggca
gagctgtactggcgatcttcctccccgaccatcgcaatgcctgtgctcctggaagctctg
gccctctccaaagaataccggttacagtacttggcctctgaaactgtgctcaacttggct
tatgcccagctcatcctggggatcccagaacaggccttaacccttctccacatggctatt
gagcccatcctggccgatggggccatcctggacaaaggccgtgccatgttcttagtgtcc
aagtgccaagtggcttcagcagcttcctatgacccagtgaagaaagcagaagctctggaa
gcagccattcagaacctcactgaagccaagaactactttgcaaaagtcgactgtagagag
cgcatcagggatgtgtcgtacttccaggccaggctgtaccacgccctcggcaagacccag
gagaggaaccactgtgccatggtcttccggcagctgcaccaggagctgccttcccatggg
gtgcccctgattaaccatctctag

DBGET integrated database retrieval system