KEGG   Rattus norvegicus (rat): 288731
Entry
288731            CDS       T01003                                 

Gene name
Pgam5
Definition
(RefSeq) serine/threonine-protein phosphatase PGAM5, mitochondrial
  KO
K15637  serine/threonine-protein phosphatase PGAM5 [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04217  Necroptosis
rno04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    288731 (Pgam5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    288731 (Pgam5)
  09143 Cell growth and death
   04217 Necroptosis
    288731 (Pgam5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     288731 (Pgam5)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 288731
NCBI-ProteinID: NP_001020443
RGD: 1312028
Ensembl: ENSRNOG00000037443
UniProt: Q562B5
Position
12
AA seq 288 aa
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDADTRTTEPLAWTGARPGHGVWDSN
WDRREPLSLINLKKRNVEFGEDELASRLDHYKAKATRHIFLIRHSQYNVDGSMEKDRTLT
PLGREQAELTGIRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVCRVSTDLLREGAPI
EPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADAKQEEDSYEIFICHANVIRYIVCRA
LQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
NT seq 867 nt   +upstreamnt  +downstreamnt
atggctttccggcaggctcttcagctggcggcctgtggtctggcgggtggctcggccgct
gttctcttctcggcggtagcggtagggaagccgagagctggcggggatgcagacacgcgc
acgacagagccgctggcctggaccggagcgcgccccgggcacggcgtctgggactccaac
tgggacaggcgagagccactgtcactcattaacctgaagaaaaggaacgtggaatttgga
gaagatgaactggcttccaggctggaccactataaggcaaaggctacaagacacatattc
ctcatccggcattcccagtacaatgtggatggctcgatggagaaggaccgcaccctgacc
ccattaggtcgggaacaggctgaactcacggggatccgacttgcaagcctgggactgaag
tttaataaaatcgtccattcctctatgacccgtgcagtagagaccacagacatcatcagt
aagcacctgccaggtgtctgcagagtcagcacagacttgctacgggaaggtgcccccatt
gaaccggatccacctgtgtctcactggaagccagaggctgtgcagtattatgaagatgga
gcccggattgaggctgccttcaggaactacatccaccgagctgatgccaagcaggaggag
gacagctacgagatcttcatatgtcacgccaatgtcatccgttatattgtttgtagggca
ctgcagtttcccccagaaggttggctccgcctgtccctcaacaatggtagtatcacccac
ctggtgattcgacccaatggtcgtgttgcactcaggacccttggggacacagggttcatg
cccccagacaagattactcggtcctga

DBGET integrated database retrieval system