KEGG   Rattus norvegicus (rat): 288736Help
Entry
288736            CDS       T01003                                 

Gene name
Foxn4
Definition
(RefSeq) forkhead box N4
  KO
K09407  forkhead box protein N
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288736 (Foxn4)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    288736 (Foxn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 288736
NCBI-ProteinID: NP_001099405
RGD: 1306389
Ensembl: ENSRNOG00000000691
UniProt: F1M4N5
Position
12q16
AA seq 476 aa AA seqDB search
MIESDIQSKMSGMIRSSGHSHHRSPQEYRFLPPAGDDDLPGDLQSLSWLTAVDVPRLQQM
ASGRIDLGSPSVPHPHPGAMAGVADPHVGAAPRPMLRSQTAMVPRGMLGLSPIGSYRASA
EQMNQFPVGGQSSSGLQEMPQLYSPATQIQFPLPSGSQQCPPTSLYGSPFAARPPYPQAH
VTVHSPQEAHPKHYPKPIYSYSCLIAMALKSSKTGSLPVSEIYSFMKEHFPYFKTAPDGW
KNSVRHNLSLNKCFEKVETKPSGSSRKGCLWALNLARIDKVEEEMHKWKRKDLAAIHRSM
ANPEELDKLISDRPESCRRPGKQGEPEVPVLTRATTVAMTHSCLAISQLPPKPLMTLSLQ
VPGDFLNISTDTNTEVDALDPSIMDFALQGNLWEEMREESFSLDTLGAFGDSPLGCDLGT
PSLTPVSGSGDQPFPDVQVTGLYAAYSTVTADSVAPSVVNSAQYLGTPGNKPIALL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaagtgacatccagtccaaaatgtcaggaatgatcagaagctccgggcacagc
caccaccgctctccacaggaatacaggttcctgcctcccgcgggtgatgacgacctccct
ggggaccttcagtcactgtcatggctcacagccgtggacgtgcctcgactgcagcagatg
gcaagtgggaggatagacttgggcagccccagtgtaccacatccacacccaggtgccatg
gctggggtggcagacccgcacgtgggtgcagccccacgtcccatgctccgtagccagacc
gcgatggtccccagaggcatgctgggcttgagccccataggcagctacagagccagcgcc
gagcagatgaaccagttccccgtaggagggcagtcatcatcgggcctgcaggaaatgcca
cagctgtactctccggctacccaaatccagttccctctgccttccggttcccagcagtgt
cctcccaccagcctctatggctctccattcgcagcccggcctccctacccgcaggcccac
gtgactgtgcattcacctcaagaggcacaccccaaacactaccccaagcccatctactcc
tacagctgtctgatcgccatggctttgaagagtagcaagacaggcagcctgcccgtgagt
gagatctacagcttcatgaaggagcacttcccctacttcaagacagcacctgacggctgg
aagaactcagtgagacacaacctgtccctgaacaagtgctttgagaaggtggaaaccaag
cccagtggctcctcgcgcaagggctgcctgtgggccctgaacctggcgcgcatcgacaag
gtggaggaggagatgcacaagtggaagaggaaggacctcgccgccatacaccgcagcatg
gccaaccctgaggagttagacaagctcatctcagaccgcccagaaagctgccggcgtcct
ggaaaacaaggggagcctgaggtccctgtgctgacccgcgccacgacggtggccatgacc
cacagctgcctggccatctcccaactcccacctaagccactgatgaccctgtccctgcag
gttcctggggacttcctcaacatcagcactgacacgaacacagaggtggacgccctggac
cccagcatcatggacttcgctctacagggtaacctgtgggaagagatgagggaggaaagc
ttcagcctggacacgctgggggccttcggagactccccacttggctgtgacctgggaacc
ccaagcctgacccctgtctctggcagcggtgaccagccctttccagatgtgcaggtgaca
ggtctctatgcggcctattccactgtcacagcagacagtgtggccccatccgtggtcaac
tctgcacagtacctgggaactccggggaacaagcccattgctctgctttga

DBGET integrated database retrieval system