KEGG   Rattus norvegicus (rat): 288743Help
Entry
288743            CDS       T01003                                 

Gene name
Sgsm1, Rutbc2
Definition
(RefSeq) small G protein signaling modulator 1
  KO
K21847  small G protein signaling modulator 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288743 (Sgsm1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    288743 (Sgsm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RUN PH_RBD RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 288743
NCBI-ProteinID: NP_001099407
RGD: 1308178
Ensembl: ENSRNOG00000000708
UniProt: D3ZAS2
Position
12q16
AA seq 1093 aa AA seqDB search
MASVPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRR
AAGFLRSNKIAALFMKVGKGFPPAEELSRKVQELEQLIESARNQIQGLQENVRKLPKLPN
LSPLAIKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSIS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFR
IIYPGTQSEFVPQDLMDVSMNNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPL
KLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTASIWE
QYIQDSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYA
QTMSEWLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNESSQSCSSGR
QNLRLQSDSSSSTQVFESVDEVEQTEAEGRSEEKHPKIPNGNPANGTCSPDSGHPSSHNF
SSGLSEHSEPSLSTEDSVLDVQRSLPAVFRPGDSSVEDGQSSEATTSRDEAPREELAVQD
SLESDLLANESLEEFMSIPGSLDVALPEKDGAMMDGWPGEADKHGRADSEDNLSEEPEME
SLFPALASLAVTSSANNETSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRSYWYFTA
ANLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPH
GGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWE
TIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLAR
DLVHKVQILIENK
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtccctgcggaggccgagacccgccagaggctgctgcgcaccgtgaagaag
gaggtgaagcagatcatggaggaggctgttacccgaaagttcgtccatgaggacagcagc
cacatcatctccttctgcgcggccgtggaggcctgcgtgctgcatggactgcggcggagg
gcggccggcttcctgcgaagcaacaagatcgcggcgctcttcatgaaggtgggcaagggc
ttccctccggccgaggagctgagccgcaaggtccaggagctggagcaactcattgagagc
gcgcgaaaccagatccagggcctgcaagagaacgtgcggaagctgccgaagctacccaac
ctgtccccgctggccatcaagcacctgtggatccgcaccgccctgttcgagagggtcctg
gacaaaatcgtccactacctggtagaaaacagcagtaaatattacgagaaggaggcgctc
ctgatggacccggtggacggacccatccttgcatctttgttggtggggccgtgtgcccta
gagtataccaagatgaagactgcagaccacttctggactgacccctcagccgacgagctg
gtccagagacaccggatccacagttcgcatctgagacaggattcacccaccaagcggccg
gcgctctgtatccagaagaggcattccagcggcagcatggacgaccgaccatccatatct
gcccgggactatgtagaatctctgcaccagaactccagggccaccctgctctacggaaag
aacaatgttctggttcagccaagggatgacatggaagccgtgccaggatacctgtctctg
caccagacagctgatgtcatgaccttgaagtggacacccaatcagctgatgaacgggtct
gtgggggacctggactacgagaagagtgtctactgggactacgctgtgaccatccgctta
gaggagatagtttacctgcactgccaccaacaagtggacagcggcgggaccgtcgtgctg
gtgagccaagatggaatccagaggccgcccttccgcttccccaagggcgggcacctgcta
caattcctctcctgtctggagaatgggctgcttccgcatgggcagctggacccgccgctt
tggtcacagcgaggaaaggggaaggtgtttcctaagttgcgcaagcggagtccacagggg
tcctctgagtccacgtcttcagacaaagaggatgatgaagccacagattacgttttccgc
atcatctaccccggcacccagtctgagttcgtgccccaggacctaatggacgtctctatg
aacaaccttccatccctatggcaacccagtcctcggaagtcctcctgctcttcctgttca
caaagcggctcagctgacggcagctcaaccaatggctgtaaccacgagagggctccactg
aaactgctctgtgataacatgaagtaccagatcctctccagagccttctatggatggctc
gcctactgcagacacctgtccaccgtgaggacccacctgtcagccctggtcaatcacatg
atcgtgtctccagacctgccctgtgacgctgggcaagggttgacggccagcatctgggag
cagtacatccaggacagcacgacttacccggagcaggagctgctgcggctcatctactat
ggaggtgtccagcctgagatccgcagggcagtgtggcccttcctcctgggccactaccag
tttgggatgacagagatggagaggaaagaggtggacgagcagatccacgcctgctacgca
caaaccatgtcggagtggctgggctgtgaagccatcgtgagacagagggagcgggagtcc
cacgcggctgccctggccaagtgctcttccggagccagcctggacagccaccttcaccgg
atgctgcaccgggactctaccatcagcaatgagtcctcccagagctgcagctcaggccgc
cagaacctccgactgcagagcgattccagcagcagcacacaggtatttgagtcagtggat
gaggtggaacagacagaggcagaaggcaggtcagaagaaaaacaccccaagatccccaat
gggaacccagcaaacggcacttgctccccagactccggacacccttcctcccacaacttc
tcctccggcctctcagagcactcagagcccagtcttagcaccgaagacagtgtcttggat
gtccagcgcagcctccccgctgtgtttcggcctggggacagcagtgtggaagacggacag
agcagcgaggccaccacttcccgggacgaggccccccgggaggagctggcagtacaagac
agtcttgagagtgacctccttgccaacgagagcttggaggagttcatgtccatccctggc
agcctggacgtggccctgcccgagaaggatggcgccatgatggacggctggcctggcgag
gcagacaagcacggtcgggctgacagcgaggacaacctctcagaggagccagagatggag
agtctgttccctgccctggcttctctggctgtgacctcctctgccaacaacgagacgtcc
cctgtgtcctccagtggcgtcacctactctccagagctactggacctgtacacggtgaac
ctgcaccgcatcgagaaagacgtgcagaggtgcgaccgcagctactggtacttcacagcc
gccaacctggagaagctgaggaacatcatgtgcagctacatctggcagcacatcgagatt
ggctatgtccagggcatgtgtgacctcttggctccgctgttggtcatcctggatgacgag
gccctagccttcagttgcttcacagaactcatgaagaggatgaaccaaaacttcccccat
ggaggcgccatggacacacacttcgccaacatgaggtctctgatccagatcctggactct
gagctcttcgagctgatgcatcagaacggcgactacacccacttctacttctgctatcgc
tggttcctgctagatttcaaacgagaactggtctatgatgacgtcttctccgtgtgggag
actatctgggcggctaagcacgtgtcctccgcccactacgtgctgttcatcgcgctggca
ctggtggaggtctaccgagacatcatcctggagaacaatatggacttcaccgacatcatc
aagttcttcaatgaaatggccgagcggcacaatgcaaagcagattctgcagcttgcccgg
gacctcgtgcataaggtgcagattctgattgagaacaagtga

DBGET integrated database retrieval system