KEGG   Rattus norvegicus (rat): 288752
Entry
288752            CDS       T01003                                 

Gene name
B3gnt4
Definition
(RefSeq) N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 precursor
  KO
K07971  beta-1,3-N-acetylglucosaminyltransferase 4 [EC:2.4.1.149]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    288752 (B3gnt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    288752 (B3gnt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     288752 (B3gnt4)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   288752 (B3gnt4)
SSDB
Motif
Pfam: Galactosyl_T Fringe DUF604
Other DBs
NCBI-GeneID: 288752
NCBI-ProteinID: NP_001099408
RGD: 1309612
Ensembl: ENSRNOG00000008544
UniProt: D4A3H6
Position
12
AA seq 349 aa
MLRRLGCVLFCTLVVLLLGCLLFLKERTPAGSSEAHQHFLAPPRPHHSQCSPNLTVVNTS
LSLPSRHRLFLTYRHCRNFSILLEPSECARDIFLLLVIKSQPAHIEQRAAIRSTWGRGGS
WARGRQLKLVFLLGVAGPVPPAQLLAYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAA
ACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDLLVGDVIRLARPNRNTKVKYFIPFSM
YRARHYPPYAGGGGYVMSQATVRHLHTAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFK
TFGIQQPLNPRDPCLYRGLLLVHRLSPLEMWTMWALVTDERLECAARKP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgttgcgcaggctgggctgtgtgctgttctgcactcttgtggttctgctgctcggctgc
ctgctctttctgaaggagcgaacaccagcaggcagctctgaggcccaccagcacttcttg
gcaccgccaaggccccaccacagccagtgctcacccaacctaacagttgttaacacctcc
ctgtccctgcccagccgtcatcgcctcttcttaacctatcgtcattgccgaaacttctcc
atcttgctggagccttcggagtgtgccagggacatcttcctgctcctggtcatcaagtct
cagccggctcatattgaacagcgtgcagccattcggagcacttggggccggggtgggagc
tgggctagaggccggcaactgaagctggtgttcctcctgggggtggcaggacctgtgccc
ccagcccagctgctggcctatgagagttggcagttcgatgacatcctacagtgggacttc
gctgaggacttcttcaatctgaccctcaaggagctgcatgtgcagcgctggatagccgct
gcctgcacacaggcccacttcatactaaagggggacgatgatgtctttatccatgttccc
aatgtgcttgagttcttggagggctgggatccagcccaggacctcctggtgggagatgtc
atccgcctggctcggcccaacaggaacaccaaagttaaatatttcatcccgttttccatg
tacagggcccgccactatccaccttatgcaggaggtggaggctatgttatgtcccaggcc
actgtgaggcatcttcacacagccatggaggaggcagaactcttccccattgatgatgtc
tttgtggggatgtgcctgaggaagctgggggtgactcccatacaccatgctggcttcaag
acatttggaatccaacagcccctcaaccccagggacccctgtctgtacagagggctcctg
ctggtgcaccgtctcagccccctggagatgtggaccatgtgggcactggtgacagatgag
aggctggagtgtgcagctcgcaaaccctag

DBGET integrated database retrieval system