KEGG   Rattus norvegicus (rat): 288771Help
Entry
288771            CDS       T01003                                 

Gene name
Rbms2
Definition
(RefSeq) RNA binding motif, single stranded interacting protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Es2 BRAP2 PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 288771
NCBI-ProteinID: NP_001020574
RGD: 1304813
Ensembl: ENSRNOG00000003076
UniProt: Q4QR81
Position
7q11
AA seq 379 aa AA seqDB search
MLLSVTSRPGISTFGYNKNNKKLYVAQQMAPPSPRNGTPNSSSGSGGNDQLSKTNLYIRG
LQPSTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTALKASGV
QAQMAKQQEQDPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDTTGASRGVGFARM
ESTEKCEAIITHFNGKYIKTPPGVAAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWPRNG
DMGGMALTYDPTTALQNGFYTAPYSLAHSRMLAQSALAPYLPSPVSSYQGSVLTPGMDHP
LSLQPASMMGPLTQQLGHLSLNSLGTFMPAAAAMQGTYISQYPAVPSSSVSVEESNGQQS
QLAVEPPSDHGVYPFQFSK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctgctatcagtgacttccaggcctgggatttcgacttttggctataacaagaacaac
aagaagctgtatgtggctcagcaaatggcacctccgagtccaaggaacggcacccctaac
agcagcagcgggagcggtgggaacgaccagctgagcaaaaccaacctgtatatccgagga
ctgcagccaagcactactgaccaggacctggtcaagctctgtcagccgtatggcaagatt
gtctccaccaaggccatcctggacaagaccacaaacaagtgcaaaggctatggcttcgtg
gacttcgacagtccgtcatcagcacagaaggctgtaactgcactgaaagccagtggtgtg
caggcacaaatggcaaagcaacaggagcaagaccctacaaatttatacatctcaaacctc
cctctgtcaatggacgagcaagagctggaggggatgctgaagccctttggccaggttatc
tccactcggatcctccgagacaccactggggccagcagaggggtcggctttgcaaggatg
gaatccacagagaagtgtgaagccatcatcacccactttaatggaaagtatataaagacg
ccccctggagtagcagcaccttctgaccccttgctttgcaaatttgctgatggtgggcca
aagaaacgacagaaccaaggaaagtttgtgcaaaatggacgggcctggccaaggaacgga
gatatgggtggaatggccttgacctatgaccccaccacagctcttcagaatgggttctac
acagctccttacagtctcgcccacagcagaatgctcgctcagtctgcactagccccgtat
cttccatcgcccgtgtcttcctaccagggctcagttctgacaccagggatggaccacccc
ctctctctccagcctgcctccatgatgggacctcttactcagcaactggggcacctgtca
ctcaacagcctgggcacgttcatgccagcagccgctgctatgcaaggaacttacatctcc
cagtacccagctgtgccttcttccagtgtttctgttgaggagagcaatggtcagcagagt
caactggcagtggagcccccctcagaccatggggtctatcctttccagttcagcaagtag

DBGET integrated database retrieval system