KEGG   Rattus norvegicus (rat): 288774
Entry
288774            CDS       T01003                                 

Gene name
Stat2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    288774 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    288774 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    288774 (Stat2)
   04625 C-type lectin receptor signaling pathway
    288774 (Stat2)
   04062 Chemokine signaling pathway
    288774 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    288774 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    288774 (Stat2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    288774 (Stat2)
   05160 Hepatitis C
    288774 (Stat2)
   05171 Coronavirus disease - COVID-19
    288774 (Stat2)
   05164 Influenza A
    288774 (Stat2)
   05162 Measles
    288774 (Stat2)
   05168 Herpes simplex virus 1 infection
    288774 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    288774 (Stat2)
   05169 Epstein-Barr virus infection
    288774 (Stat2)
   05165 Human papillomavirus infection
    288774 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    288774 (Stat2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    288774 (Stat2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 PspA_IM30 IRF-2BP1_2
Other DBs
NCBI-GeneID: 288774
NCBI-ProteinID: NP_001011905
RGD: 1311649
Ensembl: ENSRNOG00000031081
UniProt: Q5XI26
Position
7
AA seq 842 aa
MAQWEMLQNLDSPFLDQLHELYSQSLLPMDVRQHLAAWIEDQNWREAVLGSDHSKANMLY
FNILDQLNQWDHYSLDSDYLLLQHNLRKFNRDIQMFPNGPTQLAEMIFNLLLEEKRILNQ
AQRAQEMQPRPAPEAAGESQQQLEIETRILDLQTAVEALVRSIRQLKDVQDVFSFRYTVL
NHKKTSSLDPHQSQQRQLVQTTANELDRMRKEVLDISKALVGRLTTLVDLLLPKLDEWKA
QQQKSCIGAPAPELQLDQLEQWLTAGAKVLFHLRQLLKQLKDMSLMLRYEGDMFGQGVDL
QNAQVTELLQRLLQRSFVVETQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLKA
EVSIDRNSELPGFRKFNILTSNQKSLTPEEGQRQGLIWDFGFLTLVEQRSVGAGKGSNKG
PLPVTEELHIISAMVEYVYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSSTPK
DQQFFCKVPKAPWSLLGPALSWQFSSYIGRGLDPEQLGMLRNKLFGKNCKTEDALLSWAD
FSKRESPPGKIPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSEERRLLKKMVSGTFLL
RFSETSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENAPENP
LRFLYPRVPRDEAFGCYYQEKVNLEERRKYLKHRLIVISNRQADELQQPLELKQDPESLE
LDAELMSVMELARDLELQSMLQVGLDLGVEPKPDPTLSPAPQILLEPDPARALNQLLPEP
DLPQDLQQLNTGEMEIFRNNINIDDVMPYGDPVLAGQSIIEEAYRSCPSHFDVDGPLIPS
ED
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaaccttgacagtccatttctggaccagttgcatgag
ctctactcacaaagcctcctgccaatggacgtccgacagcacttggctgcctggattgaa
gaccagaactggagggaagctgtactaggcagtgatcattccaaggccaacatgctatac
ttcaacatcctggaccagctgaaccagtgggaccactacagcttggactccgactacctt
ttattacagcataacttgcgaaaattcaatcgggacattcagatgtttcccaatggccct
acccagttggctgagatgatcttcaatcttctcctggaagagaaaaggattctgaatcag
gcccaaagagctcaagagatgcagcccaggccagcccctgaagcggcaggggagagccag
cagcagcttgagattgaaacaagaatcctggatttacagactgctgtggaggcgctggtg
agatccatcaggcagctgaaggatgtgcaggatgtcttcagcttcagatacacagttctc
aatcacaagaagacatcgtctttggacccccatcagagccaacagcggcagcttgtgcag
acaacagccaatgaactggacagaatgagaaaggaggtgctggacatctccaaagccctg
gttggacgattaaccaccctggtcgacctgttgctgccaaagctggatgagtggaaggct
cagcagcagaagtcctgcattggagccccagcacccgagctgcagctggatcagctggaa
cagtggttgacagctggagcaaaggtcttgttccaccttcggcagctactgaagcaactg
aaggatatgagtcttatgcttcgttatgagggtgacatgtttggccaaggggtggacctg
cagaatgcccaagtcacggagttacttcagcgtctgctccaaaggtcctttgtagtggaa
acccagccctgcatgccccagactctccatcgacccctcatcctgaagactgggagcaag
ttcactgtccgaacaagactgctggtgagactccaggaaggcaatgaatcactcaaagca
gaagtctccattgacaggaattcagagttgccaggcttccggaagttcaacattctgacc
tcaaaccagaagtccttgacccctgaggaaggccagagacaaggcttaatttgggacttc
ggcttcttgacgctggtggagcagcgctcagtgggcgcaggaaagggcagcaacaagggg
ccgctgcctgtgacagaggagctacacatcatcagcgccatggtggagtacgtttaccag
ggtctgaagatgaagctgcagacggacactctccctgtggtgattatctctaacatgaac
caactctccattgcctgggcctccattctctggttcaacatgctcagctcaactcccaag
gaccagcagttcttctgcaaagttccgaaagctccgtggagtttgctggggcctgcactc
agttggcagttctcctcctacatcggccgaggcctcgatcctgagcagctgggcatgctg
agaaacaagctgttcggaaagaactgcaagacagaggatgcactgttgtcctgggcagac
ttcagcaagcgagagagcccccctggcaagatccctttctggacctggctggacaaaatt
ctggagctggtacatgaccacctgaaggatctctggaatgatgggcgcatcatgggcttt
gtgagccggagcgaggaacgccgactactgaagaagatggtgtcgggcaccttcctgctg
cgcttcagtgagacttctgaagggggcattacctgctcttgggtggagcaccaggatgat
gataaagtcctcatctactctgtgcagccctacaccaaggaagtgctacagtcactccca
ctgacagaaatcatccgccactaccaggttctcgccgaagagaatgctcctgagaaccca
ctccgcttcctctatccccgcgtccctcgggacgaagcctttgggtgttactaccaggaa
aaagttaacttggaagaacggaggaaatacctgaaacatagactcatcgtgatctctaac
agacaggcggacgagctgcagcagcctctggagcttaaacaggatccagagtccttagag
ctggatgcagagctcatgtcagtgatggagttggcacgagacctggagctgcagtcaatg
ctgcaggtggggctggacctgggcgtagagccgaaaccagatcccacactgagtccagcc
ccacaaatcctgctggagccagacccagcacgtgcattgaatcagctgttgccagagccg
gatttgcctcaggacctgcagcagctgaacacaggggagatggaaatcttcagaaacaac
ataaatattgatgacgtcatgccctacggtgacccagtgttggctggccagagcatcata
gaggaggcttacaggtcctgccccagccattttgacgtggatggacccttgattccttct
gaagactaa

DBGET integrated database retrieval system