KEGG   Rattus norvegicus (rat): 288783Help
Entry
288783            CDS       T01003                                 

Gene name
Ormdl2
Definition
(RefSeq) ORMDL sphingolipid biosynthesis regulator 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ORMDL
Motif
Other DBs
NCBI-GeneID: 288783
NCBI-ProteinID: NP_001099410
RGD: 1305642
Ensembl: ENSRNOG00000030120
UniProt: D4A2I4
Position
7q11
AA seq 153 aa AA seqDB search
MNVGVAHSEVNPNTRVMNSRGIWLAYVILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAM
YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD
AAHFLINTASLLSVLLPKLPQFHGVRLFGINKY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgggggtggcccacagcgaagtaaaccccaacactcgagtgatgaacagtcgg
ggcatctggctggcctacgtcatcttggtaggactgctgcatgtggtgctcctcagcatc
cctttcttcagcattcctgttgtctggaccctgaccaacgtcatccataacttggcaatg
tatgtcttcctacatacagtcaaagggacgccctttgagacccctgaccaaggaaaggct
cggcttttgacacactgggagcagatggactacggactacagtttacctcctcacgaaag
ttcctcagcatttcccctattgtactctacctactggccagcttctacaccaagtatgat
gctgctcatttcctcatcaacactgcctcactgctcagcgtactgctgcctaagctgccc
cagttccatggggttcgcctctttggaatcaacaaatactga

DBGET integrated database retrieval system