KEGG   Rattus norvegicus (rat): 288790Help
Entry
288790            CDS       T01003                                 

Gene name
Olr880, ratchr7-2512199-2511261_ORF
Definition
(RefSeq) olfactory receptor 880
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    288790 (Olr880)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    288790 (Olr880)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    288790 (Olr880)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 288790
NCBI-ProteinID: NP_001000055
RGD: 1334056
Ensembl: ENSRNOG00000042424
UniProt: D3ZSJ7
Position
7q11
AA seq 312 aa AA seqDB search
MRNHTAITTFILLGLTDDPKLQVLIFLFLFLTYMLSVTGNLTIITLTLLGPHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYMMATGDNTVTYNACAAQLFFIVLFGATEFFLLAAMSYDR
YVAICKPLHYTTIMNNRVCTVLVLSCWFAGLLIILPPLGLGLQLEFCDSNVIDHFGCDAS
PILQITCSDTVFIEKIVLAFAILTLIITLVCVVLSYTYIIKTILKFPSAQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKEGVAINKVVSVLTTSVAPLLNPFIYTLRNKQVKEAFK
DTVKRIVLLTKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcatacagcaataacaacattcatcctgctgggactgacagatgacccaaaa
ctacaggttctaatttttctttttctgtttctcacctacatgttgagtgtgactgggaat
ctcaccattattaccctgacacttttgggtccccatcttaagacacccatgtactttttt
ctccgaaatttctctttcttagaagtctcatttaccactgtatgtattcccagattcctg
tacatgatggctacaggagataacactgttacttacaatgcttgtgctgctcagttgttt
ttcattgtcctctttggagcaacagagtttttcctccttgctgccatgtcctatgatcgc
tatgtagccatctgcaagcccctgcactacaccaccatcatgaataaccgagtgtgcaca
gttctagtcctctcctgttggtttgctggcctgttgatcatcctcccacctcttggtcta
ggcctccagctggagttctgtgactccaatgtgattgatcattttggctgtgatgcctct
ccaattctgcagataacctgctcagacacggtatttatagagaaaattgtcttggctttt
gccatactgacactcatcattactctggtatgtgttgttctctcctacacatacatcatc
aagaccattttaaagtttccttctgctcaacaaagaaaaaaggccttttctacatgttct
tcccacatgattgtggtttccatcacctatgggagctgtattttcatctacatcaaacct
tcagcaaaggaaggggtagccatcaataaggttgtatctgtgctcacaacatcagtcgcc
cctttgctcaacccattcatttatacacttcgaaacaagcaggtgaaagaggctttcaaa
gacacagtaaaacgaattgtccttctcacaaagaaataa

DBGET integrated database retrieval system