KEGG   Rattus norvegicus (rat): 288813Help
Entry
288813            CDS       T01003                                 

Gene name
Olr896
Definition
(RefSeq) olfactory receptor 896
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    288813 (Olr896)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    288813 (Olr896)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    288813 (Olr896)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 288813
NCBI-ProteinID: NP_001000059
RGD: 1334017
Ensembl: ENSRNOG00000031510
UniProt: D4AAQ3
Position
7q11
AA seq 316 aa AA seqDB search
MRNHTKTKEFILLGLSDDPKLQVLIFVFIFITYILSITGNLTIIILTLLDSQLQTPMYFF
LRNFSILEASFTTVCIPRFLATIISEDKTISFNNCIAQLFFLILFGITEFYLLAAMSYDR
YIAICKPLHYLTIMSQKVCTMLVFACWLVSFLIIFPALMLLLQLDYCGSNIIDHYTCDYF
PLLQLSCSNTKFLERIGFSCAVFTLMFTLVLIILSYICIIRTIVKIPSASQRSKAFSTCS
SHMIVISISYGSCIFMYIKPSAADRASLTKGVAILNTSVAPMLNPFIYSLRNQQVKKAFL
NIARKMVFFTSTSCGL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccatactaaaaccaaagagtttattcttctgggattgtcagatgacccaaag
ctccaggttttgatttttgtctttatcttcatcacctacatcctcagcatcacagggaac
ctgaccatcatcattcttaccttgctggattctcagctccagacccccatgtatttcttc
ctcaggaatttttctattttagaagcatccttcacaactgtctgtataccaaggttcttg
gccactattatctcagaagataaaaccatttccttcaacaactgcatagctcagttattt
tttcttattctatttggcatcactgaattttaccttctagctgccatgtcctatgaccgt
tacattgccatctgcaagcccctgcattacctgactattatgagtcagaaggtctgcacg
atgctagtctttgcttgctggctggtttctttcctaatcatcttccctgcacttatgtta
cttctacagcttgattattgtgggtccaatatcattgatcactatacctgtgattatttc
cctcttcttcaactttcatgttcaaatacaaagtttctagaaagaattgggttttcctgt
gctgtctttaccctaatgttcactttggtgttaataattctgtcctacatatgcatcatc
agaacgattgtgaagattccttctgctagtcagaggtcaaaggccttctccacatgttct
tcccatatgatcgtaatctccatctcttatggcagctgcatttttatgtacattaaaccg
tcagctgcagatagagcatcattgaccaagggagttgccatactaaatacttcagtagcc
cccatgctaaaccccttcatttatagcctgaggaatcagcaagtcaagaaagcctttttg
aacatagcaaggaagatggtatttttcacaagtacatcatgtggactgtga

DBGET integrated database retrieval system