KEGG   Rattus norvegicus (rat): 288861Help
Entry
288861            CDS       T01003                                 

Gene name
Olr1012
Definition
(RefSeq) olfactory receptor 1012
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    288861 (Olr1012)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    288861 (Olr1012)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    288861 (Olr1012)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 288861
NCBI-ProteinID: NP_001000071
RGD: 1332702
Ensembl: ENSRNOG00000054207
UniProt: M0R7Y7
Position
7q11
AA seq 312 aa AA seqDB search
MKNHTVPTEFILLGLSDDPELQIVIFLFLILMYILSITGNLTIIMLTLVDPHLQTPMYFF
LRNFSVLEITFTTVCIPRFLSTIVTRDKTISYNNCTAQLFFFIFLGITEFYLLTAMSYDR
YVAICRPLHYTTIMNRRVCILLVFSAWLTGFLNIFPPVILFLQLDYCGSNVIDHFACDYF
PLLQLSCSDTWLLEVIGFYSAIVILLFTLALIILSYMFIVKTILKLPSVSQRKKAFSTCS
SHMIVISISYGSCIFMYANPSAKERASLTKGVAILNTSVAPMMNPFIYTLRNQQVKQAFK
DTIQKVVLFSGK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccacacagtacccacagaattcattctattaggactgtcagatgaccctgag
ctgcagattgtgatattcctctttttaattctcatgtacatactaagtatcactggaaac
ctcaccataattatgctcaccttggtagaccctcatctacagacccccatgtatttcttc
ctcaggaacttctcagttttagaaataacctttacaactgtctgtatccctagatttcta
agcacaattgttaccagagacaaaactatttcctacaataattgtacagctcagttgttc
ttcttcatcttcctgggtatcactgaattttaccttctaactgctatgtcctatgatcgc
tatgtggccatctgcagaccattgcactataccaccatcatgaacagaagagtctgcata
ttgctagttttttctgcctggctcacagggttcctaaacatctttccacctgtcattctc
tttcttcagttagattactgtggctccaacgtcattgatcactttgcctgtgactacttc
cccctcctgcagttatcttgctcagacacatggctcctggaagtgattgggttttattct
gcaatagtgatactgctcttcactttagcattaatcattctttcctacatgttcatcgtc
aagacaattttgaaacttccatctgttagtcagaggaaaaaggctttctctacatgctct
tctcacatgattgtcatttctatttcatatggcagctgtatattcatgtatgctaaccct
tctgccaaggagagagcatcactgaccaaaggagtagctattctcaatacttctgtggct
cctatgatgaatcccttcatctataccctgagaaaccagcaagtaaagcaagcctttaag
gacaccatccaaaaagtagtgcttttctctggcaaatga

DBGET integrated database retrieval system