KEGG   Rattus norvegicus (rat): 288878Help
Entry
288878            CDS       T01003                                 

Gene name
Olr950
Definition
(RefSeq) olfactory receptor 950
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    288878 (Olr950)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    288878 (Olr950)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    288878 (Olr950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Gemini_mov
Motif
Other DBs
NCBI-GeneID: 288878
NCBI-ProteinID: NP_001001370
RGD: 1332976
Ensembl: ENSRNOG00000032325
UniProt: D3ZG09
Position
7q11
AA seq 325 aa AA seqDB search
MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLMIIFLTLLDLRLKIPMYFF
LQNFSFLEMAFTSSCTPRFLMSILTGDKTISYGACLTQLFFFFLLLITEFYFLAAMSHDR
YVAICRPLHYPLIMNSKVCHLLVLSSWVTGFLSIFPPLMLGLTLDFCASKLIDHFLCDTS
SVLQLSCTDTRFIEWMAFVIAVMTLVITLILVILSYTLIIKTILYFPSAQQQRKAFSTCS
SHMVVVSITYGSCIFMCMKTSAKERVTLNKGVAVLNTSVTPLLNPFIYTLRNQQVKDAFK
QVLRRLYYSQNSELKFRPKKHAVGP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccagtcagtagagattgtattcattttgctgggactgacagatgaccctcag
ctacaaattctgatcttcctgtttatgtttttcaattacatcttgagcctgatggggaat
ttaatgattatctttctcaccctgctggatcttcgcctcaagattccaatgtacttcttt
ctgcagaatttctccttcttggaaatggcattcacatcttcttgcactccacgtttcttg
atgagcattcttactggagacaaaacaatttcctatggtgcttgtttaactcagttattc
ttcttctttctattgctaattacagagttctacttcctggctgccatgtcccatgatcgc
tatgtagccatctgtagaccactgcattaccccttaatcatgaacagcaaagtgtgccat
ttactggtcctcagctcctgggtgactgggtttttatccatctttcccccactgatgttg
ggactcacactggatttctgtgcttccaagctgatagatcacttcttgtgtgacacatca
tctgtcctgcagctgtcttgcacagacacacgtttcatagaatggatggcatttgtcata
gctgtcatgacacttgtcatcaccttgatcttagtgattctctcctacacactcatcatc
aaaactatcctatatttcccttcagctcaacagcaaagaaaggccttttccacctgctct
tcacatatggttgttgtctctattacttatgggagttgtatcttcatgtgcatgaaaaca
tcagccaaggagagggtgaccttaaataaaggtgtagctgtgctcaacacctctgttacc
cctttgctaaaccctttcatttataccctaaggaaccagcaggtaaaggatgctttcaag
caggtgcttcgcagattgtattattctcaaaacagtgaattaaaatttaggcctaaaaag
catgctgttggaccatga

DBGET integrated database retrieval system