KEGG   Rattus norvegicus (rat): 288912
Entry
288912            CDS       T01003                                 

Gene name
Mri1
Definition
(RefSeq) methylthioribose-1-phosphate isomerase
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    288912 (Mri1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     288912 (Mri1)
SSDB
Motif
Pfam: IF-2B
Other DBs
NCBI-GeneID: 288912
NCBI-ProteinID: NP_001010947
RGD: 1307789
Ensembl: ENSRNOG00000026211
UniProt: Q5HZE4
Position
19
AA seq 369 aa
MRLEAIRYSPGSLQILDQLQLPEHCHYETLSSVQQAREAIRAMKVRGAPAIALVGCLSLA
VELQAGAGGPGLAALVAFVRDQLSLLVAARPTAVNMARAARDLTHMAAREAELEGATEET
VRERVIRFAEDMLEKDLKDNRSIGDLGARHLLEQTNPRGGKVTVLTHCNTGALATAGYGT
ALGVIRSLHEMGRLEHTFCTETRPYNQGARLTAFELVYEKIPATLITDSMAAAAMVHQGV
SAVVVGADRVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIVIEER
PSQELTDLNGVRIAAQGIRVWNPAFDVTPHELITGGIITELGVFAPEELRAALSATIFSE
GQTLDSPQM
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgagactggaagcgatccgctactcgccgggctcgctgcagatcctcgaccagctgcag
ctgccggagcactgccactatgagacgctgagctccgtgcagcaggccagggaagcgatc
cgcgccatgaaggtgcgcggcgctcccgccatcgcgctggtgggttgcctcagcctggct
gtagagctgcaggcgggtgcgggcggtccggggctcgccgctctggtggccttcgtgcga
gaccagctgagcctccttgtcgccgcccggcccacagctgtcaacatggcccgcgccgcc
cgcgatctgactcacatggcggcccgagaggcggaactagagggtgctactgaagagacc
gtgcgggaaagagtgatccgctttgccgaggacatgttggagaaagacctcaaagataac
cggagcattggcgacttgggagcccgccatctcctagagcagaccaaccccaggggtggc
aaggtgactgtgctgacccactgtaacaccggtgctctggccactgccggctacggtaca
gcattaggtgtgatccgctcactgcacgagatgggtcgactggagcataccttctgcacg
gaaacccggccctacaaccagggagcacggctgacagccttcgagctggtgtacgagaag
atccctgcgactctcatcactgacagtatggccgctgcagccatggtacaccagggtgtg
tcagctgtggtggtgggagctgatcgtgttgttgccaacggagacacagccaacaagata
ggcacctaccagctggccatcgtcgccaagcaccacggtatccccttctatgtggctgcc
cccagttcatcctgtgacctccgtctggagactggaaaggagattgtcatagaggaacgc
cccagccaggagctgactgacctgaatggagtcaggattgctgcacagggaatccgggtt
tggaatcctgcctttgatgtcaccccccacgaactcatcacaggcggcatcatcactgag
ctgggtgtctttgcccctgaggagctccgtgcagccctaagcgccaccatcttctcagag
ggacagaccctagatagtccccagatgtga

DBGET integrated database retrieval system