KEGG   Rattus norvegicus (rat): 288924Help
Entry
288924            CDS       T01003                                 

Gene name
Wdr83, Morg1, RGD1306947
Definition
(RefSeq) WD repeat domain 83
  KO
K13124  mitogen-activated protein kinase organizer 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    288924 (Wdr83)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   Complex C specific factors
    288924 (Wdr83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like PQQ_2
Motif
Other DBs
NCBI-GeneID: 288924
NCBI-ProteinID: NP_001041312
RGD: 1306947
Ensembl: ENSRNOG00000004287
UniProt: Q5BLX8
Position
19q11
AA seq 315 aa AA seqDB search
MAFPEPKPRAPELPRKQLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLL
RTYSGHGYEVLDAAGSFDNSHLCSGGGDKTVVLWDVATGQVVRKFRGHAGKVNTVQFNEE
ATVILSGSIDSSVRCWDCRSRKPEPVQTLDEARDGISSVKVSDHEILAGSVDGRVRRYDL
RMGQVTSDYVGSPITCTCFSRDGQCTLISSLDSTLRLLDKDTGELLGEYVGHKNQKYKLD
CCLSERDTHVVSCSEDGKVFFWDLVEGSLALALPVGSNVVQSLAYHPADPCLLTAMGGSI
QYWREETYEAEGGAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcctgagccaaagccgcgggcaccggagctgccgcggaaacaattgaagaca
ctggactgcggacagggcgcggtgcgagccgtgcgatttaatgtggatggcaactactgc
ctgacgtgcggcagcgataaaaccctaaagctgtggaacccgctgcgtgggacgctgctg
cggacgtacagtggccacggctacgaagtgctcgatgcggccggctcctttgacaacagc
catctctgttctggtggcggggacaagacggtggttctgtgggatgtagcaacagggcag
gtcgtgcgcaaatttcggggccacgctggaaaggtgaacaccgttcagtttaatgaagaa
gccacagtcatcctctctggttctatcgattccagtgtcagatgttgggactgccgatcc
aggaagcctgagccagtgcagacactagatgaagccagggacggcatatccagtgtaaag
gtgtcagatcatgagatcttggcaggctctgtggatggccgtgtaaggcgctatgaccta
aggatgggacaagtcacctcggactatgtgggcagccccatcacctgcacctgcttcagc
cgggatgggcagtgcactctgatatccagcctggactctactctgaggcttctagataaa
gacacaggggagctgctgggcgagtatgtgggccataaaaaccagaagtacaagctggac
tgctgcctgagtgagcgcgatacacacgtggtcagctgctctgaggacggcaaagtgttc
ttctgggacctggtagagggttccctagcactggccctacctgtgggttctaatgtggta
cagtcactggcttaccatcccgcagacccctgcctattgactgccatgggaggcagcatc
cagtactggcgagaagagacctacgaggcagagggtggagcaggctga

DBGET integrated database retrieval system