KEGG   Rattus norvegicus (rat): 289014Help
Entry
289014            CDS       T01003                                 

Gene name
Mapkapk2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04218  Cellular senescence
rno04370  VEGF signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    289014 (Mapkapk2)
   04370 VEGF signaling pathway
    289014 (Mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    289014 (Mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    289014 (Mapkapk2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    289014 (Mapkapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    289014 (Mapkapk2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    289014 (Mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    289014 (Mapkapk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     289014 (Mapkapk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   289014 (Mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Rep_trans Choline_kinase
Motif
Other DBs
NCBI-GeneID: 289014
NCBI-ProteinID: NP_835203
RGD: 631362
Ensembl: ENSRNOG00000004726
UniProt: Q80ZF4
Position
13q13
AA seq 386 aa AA seqDB search
MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAITDDYKVTSQVLGLGI
NGKVLRIFDKRTQQKFALKMLQDCPKARREVELHWRASQCPHIVHIVDVYENLYAGRKCL
LIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLY
TSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
ILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRM
TITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQVKIKK
IEDASNPLLLKRRKKARAVEDAALAH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgggctctccgggccagactccgccggcgccgttccccagcccgccaccaccc
gccccggcccagccgccgccgccgttccctcagttccacgtcaagtcgggcctgcagatc
cgaaagaacgccatcaccgacgactacaaggtcaccagccaagtgcttggcctgggcatc
aacgggaaggtgctgcggatcttcgacaagagaacccagcaaaaattcgccctaaagatg
ctgcaggactgtcccaaggcacgcagagaggtggagctgcactggagggcctcccagtgc
ccacacatcgtgcacatcgtggacgtctatgagaacctgtatgccgggaggaagtgcttg
ctgattgtcatggagtgtctcgatggtggagagctctttagtcggatccaggaccgagga
gaccaggcattcacagaaagagaggcatcagagatcatgaagagcatcggggaggccatc
cagtacctgcactctatcaacatcgctcaccgggacgtcaagcccgagaacctcttatac
acttccaaaagacccaatgccatcctgaaactcactgattttggctttgccaaggaaacc
accagtcacaactctttgaccactccgtgttatacaccgtactatgtggctccggaagta
ctgggcccagagaagtatgacaagtcctgtgacatgtggtccttgggtgtcatcatgtat
attttgctgtgtgggtatccccccttctattccaaccacggccttgccatctctccgggc
atgaagactcgcattcgaatgggccagtatgaatttcccaacccagaatggtcagaagta
tcagaagaagtgaagatgcttattcggaatctgctgaaaacagagcccacccagagaatg
accatcacagaattcatgaaccacccgtggatcatgcaatctacgaaggtccctcagact
ccactgcacaccagccgcgtcctgaaggaggacaaggaacgatgggaggatgtcaaggag
gagatgaccagtgccttggccacgatgcgtgtcgactatgagcaggtcaagataaagaag
atagaggacgcatccaaccctctgcttctcaagaggaggaagaaagctcgcgccgtggaa
gacgcggcccttgcccactga

DBGET integrated database retrieval system